Identifiers and Description

Gene Model Identifier

Contig11680.0.g120

Standard Name

RCL1

Aliases

Contig11680_0_g120

Description

RNA 3'-terminal phosphate cyclase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam01137 ) RNA 3'-terminal phosphate cyclase
  • ( pfam05189 ) RNA 3'-terminal phosphate cyclase (RTC), insert domain
  • ( pfam02724 ) CDC45-like protein
  • ( pfam05764 ) YL1 nuclear protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001014801.0004883026569571e-88RNA 3'-terminal phosphate cycl
ase family protein
SGDYOL010W9.000270655364168e-50RCL1 SGDID:S000005370, Chr XV
from 307938-309041, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11680.0.g120(coding)
ATGTCACTATAATAAGCACCGCTGGAATTTTTCGGGCATTAATACCTAAGGCAAATTCTT
GTACTATCTATTCTATCTCATAGACAAGTTATTGTGAAGAACATTAGGTCACAGGAGTAA
AACCCAGGTTTGACCGAATTTGAATTGAATCTCTTGAAATTATTGGAGAAAGTGACAAAT
GGTTGCCAGGTGAACATCAATAAGACAGGTACTAGACTAATTTTTAGGCCTGGCATGATT
GATTGCAACGAGGGAATGCCTATAGAACATGATTGCCATCTAGCCAGAAACTTGACTTAC
TACCTTGAAGTTGTAGTACCTATTGTGATATTCGGCAAAACAACCATGCATTTGACACTT
ACAGGCAACACAGATGATAATATCGATTAATCAATAGACAGCTTCAAGAATACCTGGGTG
CATCTTATTAAGCAATTTGGAGTGCCTGATGGCTCACTAGATATTTAAGTGAAGAAACGT
GGATACTCCCCATTAGGAGGTGGGCTTGTTAAAGTAACTCAGAGATACGCTAAGAAACTT
GAGAGTGTTAGTATGATTGATGAGGGTAAAATTAAACGTATCAGAGGTCTGTTAACAAGT
GCTAAGGTATCTCCCTAACTTACTACCAGAGTGGTTGATAAACTGAGAGAAGTCTTTAAT
GATTACATACCAGATGTTTGGATTCATACAGATCACTTTAAGAAAGATCAGGCTGGGGAA
TAACCAGGTTATGCTATATCCCTAGTCGCAGAAACCACTACTGGCTTGATATTCACCAAG
GATTTCAACTACAACTCCAAGGACTTCAAAATGCCAGAGGATTTGGGTTAAAAAGCTGCA
TTAGCTCTCTTAGATGAAATCTTTAATGGTGGTGCTGTGGATTCATCAAATTAATGTTTC
GCTCTTTTGCTTATGAGTCTTTCTGCTTCAGACAACATCAGCAGCTTGAAAATAGGCAGA
GTTACTGAACAATCAATTGCCATGCTCAGACACATCAAGCAGTTCTTTAACGTGCAATTT
AAAATCACAGAGTGCGATGATGATGTATACAGCGATTCTTCAGATGAAGAAGACGAAGAA
AACAAATAAATGAGTAATGAGGATGACGTGAGTGAATAGAATGGAGATGATAGCGATGCC
AGCAAGGAAGAGAGAAGGAGGCAAAAACTCAAGGAATTGCCTTAATTCCCAAAAGCCTTC
ATTTTTTCATGCATCGGTGTTGGCCTCACAAATATCTCCAGAAAGACAGAATGA


>Contig11680.0.g120(protein)
MSLQQAPLEFFGHQYLRQILVLSILSHRQVIVKNIRSQEQNPGLTEFELNLLKLLEKVTN
GCQVNINKTGTRLIFRPGMIDCNEGMPIEHDCHLARNLTYYLEVVVPIVIFGKTTMHLTL
TGNTDDNIDQSIDSFKNTWVHLIKQFGVPDGSLDIQVKKRGYSPLGGGLVKVTQRYAKKL
ESVSMIDEGKIKRIRGLLTSAKVSPQLTTRVVDKLREVFNDYIPDVWIHTDHFKKDQAGE
QPGYAISLVAETTTGLIFTKDFNYNSKDFKMPEDLGQKAALALLDEIFNGGAVDSSNQCF
ALLLMSLSASDNISSLKIGRVTEQSIAMLRHIKQFFNVQFKITECDDDVYSDSSDEEDEE
NKQMSNEDDVSEQNGDDSDASKEERRRQKLKELPQFPKAFIFSCIGVGLTNISRKTE