Identifiers and Description

Gene Model Identifier

Contig218.1.g104

Standard Name

RC3H2

Aliases

Contig218_1_g104

Description

TLD

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig218.1.g104(coding)
ATGGAAAGACTTGAAGATATGGAAATGATAGATACCTCCTCAAATTCCTGTGGTCTCTGT
AATCAATCATTTAAGGCGTCTAAGAGAGAAAAGGTGGCCTTAGATTGTGGGCATCAGTTT
TGCAAGTGCTGCTACGATGCTCTATACAACCCTTCTTAAAACTCTATTAGATGTCCATTA
CAGCACATATCACAAGTAGAAACTGACATGATTAATCTGCAATAAAAAGGTTAAAGATTG
GATCAAGATAAACTAATAGACACCATGTTAGACGTATAAATGCTAATCCTCCCACATATG
TAGAAAGATGATGTAGATTACGATAAACACAAGATATTAATCGATTCTTATCTCGATATA
CCAGCTAAGAAGAAGGAATGGGCTGAGGCCAAGTTAAAACATCAAGAGGAGACTTTAAGG
AAAATGAAACAGATAGAGGAAGAGATAAAAGATCACATACAGCCGTAATAAGTGGTTGAG
GTGGAAAATAAAGTAGAAGTGAAAAATCCAGATGATGAATTAGATCGTTTGCTGGAGGAG
CTAAATAATATGCAAGTGCCATAATAGAATGTTTAACCAGCAGTAGATGAAGAACTGGAA
AGACTGCTTAAATCGTTGGAATAACCAGCTGGTCCTGGAGAACCTGTATTCGTTCCTAAT
GCTGTGCCTTAGATAGACGCTGATCTAGACAAACTTCTCGAAGAACTAAATGCCTACATC
CCCAAAACCCTGCTTGAACAGAAAACCTTGCAAACTTTTGATATTACAGTTGAAAATCTC
AAAAACTTGAGTGTCTGGTTAGGTGCTCCAGTGGAATAATTAAGTTTATAATATAGAGGC
AGTGAAAGTTAATTTGATCTACAGTTAATGATGGATAATATAATTCAAAGTGACATGGCT
TAGGGAATTAACGATTCACCACTACTTTTCTTGTTTAAGAGTGACTATGATTATGTCTTT
GGTGCCTATACTTCTAGGCGACTTATAGAGCAAGAAAGTGACTAATATATAGACAAAAAA
GCTTTCATATTTTCTTTCACAAATAATACAGAACACAGACTTGTACGAAACCATGCAGAA
GGAGTAAATTATAGTAACGAAGGCATTTCTTTTGGAAAAGATATTCACATAACTAATTTT
GCAAATTTAGAACCTTCAAATTCTAGTCATTTAGGACATTGCTATAAGATTCCTGAGGGT
ATATCTGAAGATTTACAATTATAATGTTATTTTCCCGGTTACCCATGGTTTAAACTTGTA
GAGTTTGAATTATACAAAGTTATATATAAGTGA


>Contig218.1.g104(protein)
MERLEDMEMIDTSSNSCGLCNQSFKASKREKVALDCGHQFCKCCYDALYNPSQNSIRCPL
QHISQVETDMINLQQKGQRLDQDKLIDTMLDVQMLILPHMQKDDVDYDKHKILIDSYLDI
PAKKKEWAEAKLKHQEETLRKMKQIEEEIKDHIQPQQVVEVENKVEVKNPDDELDRLLEE
LNNMQVPQQNVQPAVDEELERLLKSLEQPAGPGEPVFVPNAVPQIDADLDKLLEELNAYI
PKTLLEQKTLQTFDITVENLKNLSVWLGAPVEQLSLQYRGSESQFDLQLMMDNIIQSDMA
QGINDSPLLFLFKSDYDYVFGAYTSRRLIEQESDQYIDKKAFIFSFTNNTEHRLVRNHAE
GVNYSNEGISFGKDIHITNFANLEPSNSSHLGHCYKIPEGISEDLQLQCYFPGYPWFKLV
EFELYKVIYK