Identifiers and Description

Gene Model Identifier

Contig22784.0.g11

Standard Name

RBM8

Aliases

Contig22784_0_g11

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08777 ) RNA binding motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001127705.002276765025871e-34RNA-binding motif protein 8
SGDYIR005W0.00000000039982266684865623IST3 SGDID:S000001444, Chr IX
from 364889-365335, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22784.0.g11(coding)
ATGAACGAAAGCGACAGATATACAGGTTTGGATCAAGATTCAGACATTGGTCCAATGAAG
TCAGTAGAAGGTTACACTCTATGCGTTTCTGGACTCCACGGTGAGGTTTAAGAAGAAGAT
CTCCAGGATTTATTCGGTGCCTATGGGTAGGTTCGCAACCTACATTTGAATCTAGACAGA
AGAACAGGTTATGTGAAGGGTTATGCATTTTTGGAATTTGAAGAGCTGAAGACAGCCAAA
AAAGTCATTGATGAACTTAATGGAAAAATGCTACTCGGTCAATAAATCAAAGTAGATTTT
GCTTTCAAGAGACCACCACAGGGCAATTGA


>Contig22784.0.g11(protein)
MNESDRYTGLDQDSDIGPMKSVEGYTLCVSGLHGEVQEEDLQDLFGAYGQVRNLHLNLDR
RTGYVKGYAFLEFEELKTAKKVIDELNGKMLLGQQIKVDFAFKRPPQGN