Identifiers and Description

Gene Model Identifier

Contig14494.0.g90

Standard Name

RBM48

Aliases

Contig14494_0_g90

Description

TATA element modulatory factor 1 TATA binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam12325 ) TATA element modulatory factor 1 TATA binding
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11054 ) Sporozoite TA4 surface antigen
  • ( pfam09074 ) Mer2
  • ( pfam01496 ) V-type ATPase 116kDa subunit family
  • ( pfam13208 ) Domain of unknown function (DUF4016)
  • ( pfam03961 ) Protein of unknown function (DUF342)
  • ( pfam04156 ) IncA protein
  • ( pfam00901 ) Orbivirus outer capsid protein VP5

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14494.0.g90(coding)
ATGGAGGCTTTGATTTGCAAGAAAAAACTTAATGGCTTTAGTTTTTATGGCAGAAAGTTA
AATGTGCAGTATGAACCAGATTTAGAGAGACTTGAAGACACTAAGGACAAAATGGAGTTT
AGATTTTAAAGAGTAAATTAAAGGCTATCAGAGCTTAAACACCAGCAAAAAAGACTCACT
AAAGAAGAAAAATAGCAATAAATAGACCAAGAAATAATAAATGAAGTACAATAAGTAGAT
AAAATATTAAAATAAAGCAAGAGTTTTAAGCAATAAGAATATGAATATAAACAATATTAG
TAGGAAAACAAAAATAAAATGGAGGTTATAGACAAGAAAAATGCTATTAGAAATTAGAAT
AAGAGATTTCAAAATAGAGTAAATTCAGGCATGAAAAAGAGAATCAAACTGTGA


>Contig14494.0.g90(protein)
MEALICKKKLNGFSFYGRKLNVQYEPDLERLEDTKDKMEFRFQRVNQRLSELKHQQKRLT
KEEKQQQIDQEIINEVQQVDKILKQSKSFKQQEYEYKQYQQENKNKMEVIDKKNAIRNQN
KRFQNRVNSGMKKRIKL