Identifiers and Description

Gene Model Identifier

Contig19748.0.g47

Standard Name

RBM42

Aliases

Contig19748_0_g47

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL016W0.00000000000006002591555650462PUB1 SGDID:S000004961, Chr XIV
from 602907-604268, Geno...
T. thermophilaTTHERM_005578100.000000009996807949091551RNA binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19748.0.g47(coding)
ATGAACGCACATCATGCTTTGATCTATGGATCTCTAGATGCTCCTTCAACTCTCTCATCT
GANTATCAATCTAAAATATCAGGTTAACCCACATAAACTTTAGAAGAAAAGAAAGAAGGT
TCCAAGACTTAAATTATTGGCTAAACAAGTACAGGAGGGATTCAGTAAAAATCATCACTA
GGGTCAGTCAGTACTAACCCCGATTCCCTGAATAACCCAAATAAGAGAAAAAAGAAAATT
CTAAGAAAGGCAGCTGGCAAATAATGGGAGGACCCTACACTCGAAGAATGGCCTGACAAC
GACTATAGAATATTTTGTGGTGACCTTGGAAATGAAGTCAATGACGATGTGCTCGCAAAT
GCATTTAAAAAGTATCAAAGTTTCGTAAAAGCTAGAGTAGTCAGAGATAAAGTCACTTTG
AAGTCAAAGGGGTTTGGATTTGTAAGCATCATGAATTAAGATGACTATATTAAGGCTATG
CGAGAGATGAATGGTAAATATGTTGGAAATAGGCCTATCAAGTTAAAGAAAAGCGACTGG
CAAGATAAAAGTGCGAGTTGCGGTGGACCCAAGAAGAAAAGCTTAAATGATTTTGGACTA
TTGGGAAAGAGAAAATGA


>Contig19748.0.g47(protein)
MNAHHALIYGSLDAPSTLSSXYQSKISGQPTQTLEEKKEGSKTQIIGQTSTGGIQQKSSL
GSVSTNPDSLNNPNKRKKKILRKAAGKQWEDPTLEEWPDNDYRIFCGDLGNEVNDDVLAN
AFKKYQSFVKARVVRDKVTLKSKGFGFVSIMNQDDYIKAMREMNGKYVGNRPIKLKKSDW
QDKSASCGGPKKKSLNDFGLLGKRK