Identifiers and Description

Gene Model Identifier

Contig7157.0.g23

Standard Name

RBM34

Aliases

Contig7157_0_g23

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08777 ) RNA binding motif
  • ( pfam13649 ) Methyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007564502.0000236365077126e-43RNA binding protein
SGDYOL041C3.9989916100764785e-24NOP12 SGDID:S000005401, Chr XV
from 252646-251267, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7157.0.g23(coding)
ATGGGAAAAGACAAATAAAAGACTCAATCACAGGAAAAACCAGAGAAGCAATCTGAAGAG
CAAAAACTTTTAAAACAAGAGAAGACAGCACAAAAGCAAAATGCTATTCAGGAACACAAG
CAGAAGAAGAAAGACAAGAAAAAGGAAAAGAAGAATAGAAAGATTAATAAAGAAAATGAA
GCCAAGGAAACTGAGGAAAAGAAGGCAGTCTAACCAGAAGAAAGCGAAGAGATTGTTGAA
GCTGAAGAACAAGCTGCAGTTGTTGATAATTCAGCAGAGGATGTAAAAGATAAATCCAAT
ACTAAAGATCAACAGAAAACAGATAAAGTAAAGAAGTCTCCAGAGTAAATCGAAGAAGAG
AATTCTGAAAGAAAATAAAGAACAACCTTCGTAGGCAATGTTCCCCTAGAAACTGAGTCC
AAAGATCTAATGAAGCTTTTCAAGCCTTATGGTAATGTCGTGAAGATCTGGTTCCGTTCA
ATTGCTTGCGATCACGAGTCAAAGATCACTCACAAGGGAAAAATCATCAAGAAGGAATAT
GGTCTCTAGAAGGATTCCAAAAACGCTTATGTGCTCTTCAAGACCAAAGAATCAGCCATT
AAAGCAGCTGAAAACTTGAATCAAATCTAACTTGGAAATAAGCACTTAAGAGTTGATACT
GAAAATTAAGAGAATGACTACGACACCACTATTTTCATTGGAAACCTTCCATGGGTCCTC
AATGACGAAGACTTGAGAGCACATTTCGAAGATTGTGGAAAGATTTTGAATGTAAGAGTC
GTTAGAGACAAGGATAATTTTATTGGCAAGGGAATTGCTTATGTTCAATTCAAGACTAAA
GAAGAAATGCGTAAATCAATTGAAACTAAGAACAGAAGCTTATTCAGAGGCAGAGAACTA
AGAATCAAGAAAGCAGTGGAGCCAAGAAGACTTGAGAAGAAAGAGAAAAAGAGAAGAGAA
ATCAAAGAACAAATGAAGACCTAGAAGAAAGACAATAAGAGAGATAGAGAATACAAAAAA
CCATCAACTGAAGGAGGTCAGGATGACTTGAGTGGAAGTGATAATGAAGATAAAGCCCCC
GCAAAAGGAAAGGATGGCGATGATTAAAAGAACGGAGGAAAAGGAAAGTTATTCATGGAC
AGAAAAACCATGAGAGAAAATGCCATGCTAAGAATTGAAAGTAAGAAAAATAAACAAGAC
AAATCATCAAAGCCTAAACCAGACACAAAGCAAAAATGA


>Contig7157.0.g23(protein)
MGKDKQKTQSQEKPEKQSEEQKLLKQEKTAQKQNAIQEHKQKKKDKKKEKKNRKINKENE
AKETEEKKAVQPEESEEIVEAEEQAAVVDNSAEDVKDKSNTKDQQKTDKVKKSPEQIEEE
NSERKQRTTFVGNVPLETESKDLMKLFKPYGNVVKIWFRSIACDHESKITHKGKIIKKEY
GLQKDSKNAYVLFKTKESAIKAAENLNQIQLGNKHLRVDTENQENDYDTTIFIGNLPWVL
NDEDLRAHFEDCGKILNVRVVRDKDNFIGKGIAYVQFKTKEEMRKSIETKNRSLFRGREL
RIKKAVEPRRLEKKEKKRREIKEQMKTQKKDNKRDREYKKPSTEGGQDDLSGSDNEDKAP
AKGKDGDDQKNGGKGKLFMDRKTMRENAMLRIESKKNKQDKSSKPKPDTKQK