Identifiers and Description

Gene Model Identifier

Contig11237.0.g24

Standard Name

RBM22

Aliases

Contig11237_0_g24

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08777 ) RNA binding motif
  • ( pfam00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and similar)
  • ( pfam13408 ) Recombinase zinc beta ribbon domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004945002.000043494209831e-96hypothetical protein
SGDYBR065C0.00000000000001000191320216021ECM2 SGDID:S000000269, Chr II
from 369678-368584, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11237.0.g24(coding)
ATGGGAGAAAGAGGTTTAGGAATCAGATCCGGTGCCACTAAGCAAGGTTGGGAGAAATCA
GATTTCCCAATTCTTTGTGACACTTGTTTGGGAGAGAACCCTTATGTTCGCATGACAAAG
TCAGAATTTGCTAGAGAATGTAAAACATGCCAGAGACCATTCACTGTCTTCAGATGGAAA
CCAGGCAATGCATGCAGATATAAGAAGACCGAAATTTGTTAAACATGTGCTAAAGTCAAG
AATGTCTGTCAGACTTGTCTCTTTGATTTAGACTTTGGACTACCAGTTGAATTGAGAGAC
AAATTCCTTGATAAGAACGAACTCGTTGCCATGCCTAAAGATGCAATAAATAGAGACTTT
TGGACTAATAGCGTAAATCAGGACATTGAAAAAATGGAGTTACCTTACTAAAACCCTGAA
GTTAAACAAGCCTTGGCCTAAATGTCTAGAAGCTTTTTGCCAAGTTATAAGAGAAATCAA
GCTCATGTTTGCAGTTTTTATGTCAAAGGTGAATGTAACAGAGGAAAGGCCTGTCCTTAT
AGACATACAAACATTTCTGAGGAGGACTTGGAATCAATGAAGAAAGGATAGGGTTCGATT
GATGAGAGAATCAGAAATCGTTTCCATGGAGTTAATGATCCAGTAGCAAAGAAGATTCTT
GATAGAGTTAAGGAGACAAACATACCATCTCCTCCTGAAGATATGAACATCACAACTATC
TTTATAGGAGGTGTCAATGACGATTCAATAAATGAAGAGACTCTGAAAGAACAGCTTGAA
TCATTTGGTAAAATAAAGGGAGTAAAACTTATTCATAAGTAAGGATGTGCCTTCGTTTGC
TTCCATGCCAGAGAATCAGCTGAGAAAGCAGTAGAAGCAATTTTCGACAGATTCTTTGTT
AATAACAAAAGATTGAAAGTCCTCTGGGCAAAGGCTTAGTTAGAATAAAACGGTGAGAAG
CCTAGGCATAAACCACATCATCAGTAAAATTCAAATTTCAGAGGAGGTATGAATAAACAT
ACAGGGTAGAAGAGAGAAGTCTAAGAAGATGGGGATGAAGAAGAAGTCAAGCAACCACCA
GTACATGATCAAGTTTAGCAATAGAACTTTATCACTTCCGAGCCCATGTCTCAGAGATAA
GCTTCAGAATAAATCAAGAAATTGGGCATTACTTAAAACGAGTAACTTAAGAAACTTATG
TTTAATTATGCTGACGATGATGAGCAGTAATCAAACACTAAAAGCGTTTAATATCCCTCT
ATGTTAGGTAAAACAACAGATGCTGGAATAGTTAACAAATAGTGA


>Contig11237.0.g24(protein)
MGERGLGIRSGATKQGWEKSDFPILCDTCLGENPYVRMTKSEFARECKTCQRPFTVFRWK
PGNACRYKKTEICQTCAKVKNVCQTCLFDLDFGLPVELRDKFLDKNELVAMPKDAINRDF
WTNSVNQDIEKMELPYQNPEVKQALAQMSRSFLPSYKRNQAHVCSFYVKGECNRGKACPY
RHTNISEEDLESMKKGQGSIDERIRNRFHGVNDPVAKKILDRVKETNIPSPPEDMNITTI
FIGGVNDDSINEETLKEQLESFGKIKGVKLIHKQGCAFVCFHARESAEKAVEAIFDRFFV
NNKRLKVLWAKAQLEQNGEKPRHKPHHQQNSNFRGGMNKHTGQKREVQEDGDEEEVKQPP
VHDQVQQQNFITSEPMSQRQASEQIKKLGITQNEQLKKLMFNYADDDEQQSNTKSVQYPS
MLGKTTDAGIVNKQ