Identifiers and Description

Gene Model Identifier

Contig8744.0.g5

Standard Name

RBM19

Aliases

Contig8744_0_g5

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1
  • ( pfam02714 ) Domain of unknown function DUF221

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004087408.002410695130318e-138probable RNA-binding protein
SGDYPR112C4.001371804839974e-78MRD1 SGDID:S000006316, Chr XVI
from 751919-749256, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8744.0.g5(coding)
ATGTCAAAACCTACCAATAGTTAATAAGCAAAGCAGAAAGAGGATCAGGATTTCCAAAAT
GAAATCCAAGCTTCTACTTCTGAGACACCAACAAGCAGACTGATTGTGAAGAACATCCCA
AAGCATTTGGATGAGCAAAGACTCAGATTACACTTCCAAAAGGAAGGAGGGCATGTGACT
GATGCAAAAATCATGAAGAAGGGCAACAAGTCCAGATTGTTCGCATTTGTAGGCTTCAAG
TCAGAAGAAGAAGCTGAGAAAGCTAAGAAATACTTTAATAATTCCTACATTGACACAAGC
AAGGTCCAGGTTGAATTTGCCTTAGCATAAAATGATCCAAAACTTTCAAGACCATGGTCA
AGGTACTCAAAGGGAAGCAGTGCTTTCTTGATGAAAAATGGCAAGGAGTCAAATGAAAAA
GCAAAAATGACAGAAGAAGAGAAGGAGCAAGTCAAATAGGAGATTGAAAACAAGAAAGAC
AAGTTTAGATCATTCCTCAAGGTCATGGGCATGTCAAAAGAAAATAAGCAATCTTGGAAT
GATAGTTTTACAGCATTTATGGCTGATGATGGGTCTGGTTTGTAACATACTGCCACAGAG
GATAAAAAGAAGAGAAAAGCCAAGGAAGAAGAAAAGAAAAATAAAAAGGAAGAAAAAGAG
AAAAAAACCAAAGATAATGATGAAAAGGTTGATGAAGACAAGCAAGAGGAAAAGAATGAA
GAAGATGATAATATTATAGATGAACAGAGAATATATGTTATGAATCTTGCTTTCACAATC
AATCACGAAGAATTAAGAGAAAAGTTTGGACCTTTTGGAGAAATTGCAGACATTGAGATC
CCATTGAGAAAAGGAGGATAAAGTTTTGGATTTGCTTTTATCAAGTATGCAACTGTAGAA
GCTGCTGTCTCTGCCTATGCTGAATTAGATAAGACATTTTATTAAGGAAGAAAATTACAC
ATTCTCCCAGCTTAAAAGAAACCACCTAAGGAAATCCCAGACTTTAATCCAACAAAGGAG
GGTGATGAGTAAAATCAATCTTAGGAAGGAGATGTAGAAATGAAAGAAAGCAATTAAAAC
TAGGAAGAATAGAAGCAACCAGAGTAGAAGCAACCAGAATAGAAGGAAAAGATCAGAGAG
AAGAAGTCTACTTTCAAGGAAGAGAAAGAAAAGGAAGTAAAAGAAAACTTTGATGATGAG
ACTAACTGGAACTATTTATTTATGAATCAAGATGCAGTTGCAACTTCAATGGCATCCAAA
CTTAACATTAGCAAGGGCAGTTTGTTAGATAGGGATCAGAAGAATCTCGCAGTAAGAGTA
GCAAAAGCAGAAACAATCATTATCAACTAAACCAAAGAATGGATGAAAGAAAATGGCATT
GATCTTGATAGACTAGAGAGAACTGACAGACTAAAATGCAAAAGATCCCACACTGTCATC
ATAGTTAAGAATATCCCTTATCATACTAAAGAGTAAGATATCAGAGAAGTGTTTGAGAGA
TATGGTGTTCTCAAAAGACTCCTCCTATCTCCATTCAATACTTTAGCCTTAGTAGAATAT
GACAATGAGAAATAGGCTAAGACTGCGATGAAAAACTTATAGAACCATAAAATTAACTAC
ATTATGCCAATATATTTGGAATATGCCCCAGTTATTATTTCAAAGAGTGCTGCTTTGACT
AAGGAAGATGAGAAGAAAGTTCAAGAGAAAGAAGTTGAAGAACAAAAACAGTAGGAAGAT
AACGATTAAAAAGGAGAAAGAACTATTTTCGTCAAGAATCTAAATTTCTCAACAGTTGAA
GAGCAATTAGAACAAGTCTTTAAAGAAGCAAAGGTTGGAAAGATTCTATCTTGCAAAATT
GTGAAAAACAATGAAAATTAATTATCCCGTGGTTACGGTTTCGTTGAATTAGAGAGCAAA
GAAATGGCAGAGAAAGCAATTAAGAAGCTATAAAACTTCATTTTGGATGAGCATGCATTA
AAACTAAGTATCTCTAAGAAAGACGTCACTAAGGCTGAGAAGAAAAGTAACGATGATTAA
CTTGGCAAGAGAAAAGAAAAAACTGAACTCTCTAAAGTTGAGGCACAGGAAGATCTACAA
TCTAATAAGTTGCTTGTCAAGAATTTGGCATTTGAAGCTACTGATAGTGATATCAAGGAA
CTCTTTAAGACATATGGAGCACTTAAAAAATGCAGACTACCCAAGAAAATCAACTCCAAA
AGTCATAGAGGTTTTGGTTTCGTAGAGTTTGTCTCAAGCGAAGAAGCCAAGAATGCTTTC
AAAATGCTATAACATACTCATTTGTACGGAAGAAAGATCATCATAGAATGGGCAAAGCCA
GAAGTTGACATGGGAGGAAACGAAAACAATGTGGATGTTGAAGGCAATAAAAATAAAAGA
CAAAGGAATAAATGA


>Contig8744.0.g5(protein)
MSKPTNSQQAKQKEDQDFQNEIQASTSETPTSRLIVKNIPKHLDEQRLRLHFQKEGGHVT
DAKIMKKGNKSRLFAFVGFKSEEEAEKAKKYFNNSYIDTSKVQVEFALAQNDPKLSRPWS
RYSKGSSAFLMKNGKESNEKAKMTEEEKEQVKQEIENKKDKFRSFLKVMGMSKENKQSWN
DSFTAFMADDGSGLQHTATEDKKKRKAKEEEKKNKKEEKEKKTKDNDEKVDEDKQEEKNE
EDDNIIDEQRIYVMNLAFTINHEELREKFGPFGEIADIEIPLRKGGQSFGFAFIKYATVE
AAVSAYAELDKTFYQGRKLHILPAQKKPPKEIPDFNPTKEGDEQNQSQEGDVEMKESNQN
QEEQKQPEQKQPEQKEKIREKKSTFKEEKEKEVKENFDDETNWNYLFMNQDAVATSMASK
LNISKGSLLDRDQKNLAVRVAKAETIIINQTKEWMKENGIDLDRLERTDRLKCKRSHTVI
IVKNIPYHTKEQDIREVFERYGVLKRLLLSPFNTLALVEYDNEKQAKTAMKNLQNHKINY
IMPIYLEYAPVIISKSAALTKEDEKKVQEKEVEEQKQQEDNDQKGERTIFVKNLNFSTVE
EQLEQVFKEAKVGKILSCKIVKNNENQLSRGYGFVELESKEMAEKAIKKLQNFILDEHAL
KLSISKKDVTKAEKKSNDDQLGKRKEKTELSKVEAQEDLQSNKLLVKNLAFEATDSDIKE
LFKTYGALKKCRLPKKINSKSHRGFGFVEFVSSEEAKNAFKMLQHTHLYGRKIIIEWAKP
EVDMGGNENNVDVEGNKNKRQRNK