Identifiers and Description

Gene Model Identifier

Contig11888.0.g7

Standard Name

RBM11

Aliases

Contig11888_0_g7

Description

PWI domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01480 ) PWI domain
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00913 ) Trypanosome variant surface glycoprotein (A-type)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000239202.0004286606204839e-16hypothetical protein
SGDYNL175C0.0000009995106777214876NOP13 SGDID:S000005119, Chr XI
V from 308612-307401, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11888.0.g7(coding)
ATGAGTTACTAGTAGCGATAGAATCAACATGGTTCTTAATCAGTAATAGCATCCTCTGGC
TATCAACTGAACCCAGTGGGTCTTCTGACTTCTGGTTAATAATTTGCTTAACAACATCAT
ATGCCTTAAAACATGTCCAATCAGTAACCCACTACTACCACAATATTGGTCAATCCTCCT
CCCTCTTAGAGATCCATTGCTGAGTAATATTTGAAGCCTATTCCTACTCTTAATATGGAA
GAAAATCGCAAACTTTATGTTGGAAAGATCCCTAAGAATGTCACAGATGATTTTATGGAA
AGGTTATTCAGATGTTGCGGATAATTAATATCCTGGAAGCGTTCAACCGATGCCAGTGGC
GAGCCCAAAGCTTTCGGTTTTGTGGAGTTTGAAAACATCGAATCAGTATTTGCCTGTCTA
AAAATAATCAACAATCTCCCTCTTATGGACTCCAGGATAATAGTCAAAGCCAATGAGAAG
ACTAACCAATTCCTGAATGACTGGAGAGAGCTCAAGAAAATGGATTGGCTAAGCAAAATG
GAAAAAACCGGACAGTAAGTTGACAATGAAGACTTAGAGTACAAAGAGCAGCTTGGTGAG
TTAATGCCCTATGAACAGGAGCTAATTCCAAATTACGATGAAGTCATCAATGAAATCCAA
AACACCATAGAAAAGAAGGAAATCATCGAGTAGGTAGCAGCACAGTAAAAGCAGAGTGAG
TAACCAGTGAAACAATCACAGTATGAAAGTGATCCATTCCAGAAGTACAAAGAGCACGAA
AGAGAGCAGAGAAGAGAAAGACGCATTAAGAATATTGAGAGGGAACGTGAAGGCAAGTTT
TAGAAGAAAGTGGAGGAGTGGCTGCAGAGAGAGGCCAACAGAGACAGGGAGAAAGAGAGG
GAAGCTGAAAGAGAGAAGGATAGGCTCAGGGATAAAATGAAGCTAATAGAACAAGATTTA
AATTATGATAGTGGCGAAGAGAAGAAGAAGCGCAAGAAGAATCCACGAGAATATGAGAGA
TATCTAGAAGAAAGAAAGCGCATAAGAGAAAAGGAAAGAGAGGACGACGAAGCAGATAGA
AAGAAGGAAGCTGAGGAGATGATCGAGCTTGAGAAGAAGAGAGCGGAAGAACGAAGGAAA
CAAGAGGAGCAAAAGCGCAGAGAGGATGAAATCAGGGAGAGGTTGAAGCTCAAGAGATTC
ATGGAATTGGAGGAAATGGAGAGATAAAAGTAACATGAAGAAGAGCAGCAGTAGCAATTA
TAGCAACAGCAGTAGCTTGAATCGAGTGGGAAAAGATAGAAAATTAACGAGGGGTAGGTA
GGAAATACAGACTATGCAGCTGGTATGGGTTAAGGAAGAGCTGGATTAATGACTAACAGT
TTTGCGTAACCTCAAGCACCGGGGTAATAACAGCAATAGCAATCAGAACCATATAGCTAT
CAGTAGCAGTAAATGGATAACTATAGAATTTAGAGATTTGGAGCAGCAGACTAAGATGAA
CAGAAATCCGAATATGATCAATATCAAATGAAAAAGCACAAGCCATTTGCTAAACTTTCA
GAAAATACAGTCTAAAATATTAAGAATATTGAGAGCGAAATGAGAGGGAAGGATCATAGT
AGAGATGACAGAAGAGAAAGAGATAAGAAATATGATGGCAAGTAAAAGCTGAAAGAATAC
ATGGAAGACGAGGAAAAACGTAAGATCCTTGAAAAAACTAAAGAACTCTATGCCAAACTC
CCAAAATCTAAAGAAGACATTTTCAAGTCCCCCCTGAATTGGAACTCTCTCCTCCGCTAC
GATGTTATTGAGAAAGTTGGAAGGCCTTGGATTGGCAAGAAAGTCAAGGAATACATGGGA
GTGGAAGACTAGAGTATAGTCTCGCTAATTATTAAGATTTTGAATTAAAAATTAGATCAT
TAGTAGCTACAAGCCAAGATGAAGGATATATTTGATAAGAAAACTGAGGAGTTCGTTATG
AAGTTGTGGTAAACATTCACATTCGAAAATATGAAGATTGATGAGGGACTATACGAGAGT
ACTAACTAATGA


>Contig11888.0.g7(protein)
MSYQQRQNQHGSQSVIASSGYQLNPVGLLTSGQQFAQQHHMPQNMSNQQPTTTTILVNPP
PSQRSIAEQYLKPIPTLNMEENRKLYVGKIPKNVTDDFMERLFRCCGQLISWKRSTDASG
EPKAFGFVEFENIESVFACLKIINNLPLMDSRIIVKANEKTNQFLNDWRELKKMDWLSKM
EKTGQQVDNEDLEYKEQLGELMPYEQELIPNYDEVINEIQNTIEKKEIIEQVAAQQKQSE
QPVKQSQYESDPFQKYKEHEREQRRERRIKNIEREREGKFQKKVEEWLQREANRDREKER
EAEREKDRLRDKMKLIEQDLNYDSGEEKKKRKKNPREYERYLEERKRIREKEREDDEADR
KKEAEEMIELEKKRAEERRKQEEQKRREDEIRERLKLKRFMELEEMERQKQHEEEQQQQL
QQQQQLESSGKRQKINEGQVGNTDYAAGMGQGRAGLMTNSFAQPQAPGQQQQQQSEPYSY
QQQQMDNYRIQRFGAADQDEQKSEYDQYQMKKHKPFAKLSENTVQNIKNIESEMRGKDHS
RDDRRERDKKYDGKQKLKEYMEDEEKRKILEKTKELYAKLPKSKEDIFKSPLNWNSLLRY
DVIEKVGRPWIGKKVKEYMGVEDQSIVSLIIKILNQKLDHQQLQAKMKDIFDKKTEEFVM
KLWQTFTFENMKIDEGLYESTNQ