Identifiers and Description

Gene Model Identifier

Contig21440.0.g86

Standard Name

RBBP6

Aliases

Contig21440_0_g86

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKL059C0.0000000000009003435339752751MPE1 SGDID:S000001542, Chr XI
from 329443-328118, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21440.0.g86(coding)
ATGGTTCTCAAAAGATTACCAATTGAGAATGAGTAAGAGCCAGCTTTTAAAATTGGTTAT
TACATTAAAGTTGCTGAAAACATAGATGAGTCTTTAAAGGTTTAGATTTATGACAATAAG
TCTGGTGAGCTATACAAAGATAATGATTTAATAATGAAAGATTCATTCTTGGATTTTGAA
ACAATAACTCAGCAAGAATTCTAAAAGCAAAATCAACAAGCCTAATAGTAATAGGCACAA
GAAGAAGCAGCTAAGAAATAGGCAGAGATTGCATTGCAACAGAAATTACTGGAGCAAACT
TAGCAATAAGCAGCTAAAGACAGTTTTATGAATATTATGAATGAAAACAAGTAAAAAACG
AGGGAGCATGTAAAGCAACAAAATTAAATAGCTTTTAGTCAGAACGATGGCGCTGGTGGT
CATCACTATCAAAAACCCTAATATAACTCTAACTAATTCTAAGATAGAAATGCAAACCTG
AACAACCCCTAATTTGCTGGGTTCAGGCCCAAGCATGAAATTCATAGTGGGTACGTTTGT
ATAAGATGCAAGATTAAAGGTCATCATGTTAAGGACTGTCCAACAAATTTCGACCCCACC
TATGATCCTTATCAAGGAAAAGGTGTGCCAAAAGAGCAAGTATGGAAGAGGGATTTAGGT
ATAAGTAATTAAGAGTTCCTTGATAACAAGCACAAAGTATTTAGAGATATAGTGAAGGAA
TCAAAGATCTATGAGGGGCAATTTGAAGTTCAGAAGTTTAAGTAGCAATAGGAAAATCCA
AGCGATATGTTCAATCAATAGAATGATGGTGAAACTATAGTCACTGTTGTACCAGACTGG
TAAAAACAAATCCCTCCTTCATTAGTTTGCTAACTATGCAAGGACTTTATTAAGAGAGCT
TCCTTAACTAAGTGCTGCGCTTCATCAGGTTGCTAAAAATGCATTTAATAGAAGCTAGTC
GAGAGAAAATTTCAATGTCCTTTCTGTTCAACTGTGAACGTCTACGCAGAGGATATTATA
CCAAATTAACAGCTTAGACTTGTGGCTGAATGGTTTAAAAGACAAATGTTGATATAGGAT
AAAATTGAGGAGGTCGAGATTAAGAGAAACTAGAATTAGGATTAAGACGAGATGATATAT
ATGATTACCAAAATTAATCAGACTTTCTAACAGAATGCTCTATAGCAATAGATGATGCAA
CAGCAATTTATCCAAGAGAATTATGAGAGCGATGCTTATTCTCAAAATGAACAAGATCAA
GTTGCAGAGCAACAAACTTTAAATCAAGATTAGATTTCGACAGGCTAGACTGATGGACAA
GATAAGGCAAGTTAGTCAGCACAAAATCCCTTAAAATTCAATCCATCAATTCATTCAGGG
ACAAAATACGATCCAACTTTGGGAAGAAGGGTTCCAGTTACTGATCCTAATGAACTACCC
AAAATTCAAGGCTAAGCAGTGGCAGGTACCAGTATGGCTGAACTTCAAATGAGATAGTAG
CAATTCATGTAAATCTAAATGATCTAAATGCAAATGGCTGCGATGAGAAACTACTAGTAA
TATTAAGGAGGGTATATGCCAGGTCAAGGTATGATGTAACCTGGAATGATGCCTTCAGCA
GGCATGAACATGCAAGGAATGATGATGAATTAGGGTTATGGTCAAGGACAGAGTCAGAGT
GAGAGACAGCATGGAAATCAAAATTAGAGAGGAGTCAGGAGAAGCAGAACGAGATCAATT
TGA


>Contig21440.0.g86(protein)
MVLKRLPIENEQEPAFKIGYYIKVAENIDESLKVQIYDNKSGELYKDNDLIMKDSFLDFE
TITQQEFQKQNQQAQQQQAQEEAAKKQAEIALQQKLLEQTQQQAAKDSFMNIMNENKQKT
REHVKQQNQIAFSQNDGAGGHHYQKPQYNSNQFQDRNANLNNPQFAGFRPKHEIHSGYVC
IRCKIKGHHVKDCPTNFDPTYDPYQGKGVPKEQVWKRDLGISNQEFLDNKHKVFRDIVKE
SKIYEGQFEVQKFKQQQENPSDMFNQQNDGETIVTVVPDWQKQIPPSLVCQLCKDFIKRA
SLTKCCASSGCQKCIQQKLVERKFQCPFCSTVNVYAEDIIPNQQLRLVAEWFKRQMLIQD
KIEEVEIKRNQNQDQDEMIYMITKINQTFQQNALQQQMMQQQFIQENYESDAYSQNEQDQ
VAEQQTLNQDQISTGQTDGQDKASQSAQNPLKFNPSIHSGTKYDPTLGRRVPVTDPNELP
KIQGQAVAGTSMAELQMRQQQFMQIQMIQMQMAAMRNYQQYQGGYMPGQGMMQPGMMPSA
GMNMQGMMMNQGYGQGQSQSERQHGNQNQRGVRRSRTRSI