Identifiers and Description

Gene Model Identifier

Contig21633.0.g19

Standard Name

RARS2

Aliases

Contig21633_0_g19

Description

tRNA synthetases class I (R)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00750 ) tRNA synthetases class I (R)
  • ( pfam05746 ) DALR anticodon binding domain
  • ( pfam08597 ) Translation initiation factor eIF3 subunit
  • ( pfam01406 ) tRNA synthetases class I (C) catalytic domain
  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam01113 ) Dihydrodipicolinate reductase, N-terminus
  • ( pfam04060 ) Putative Fe-S cluster
  • ( pfam08706 ) D5 N terminal like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006572702.0001055857497602e-161arginyl-tRNA synthetase family
protein
SGDYDR341C1.000499495426459e-47YDR341C SGDID:S000002749, Chr
IV from 1153626-1151803, ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21633.0.g19(coding)
ATGTTATCACTACCAAAGCATTTAGGTGGCATTATCGGAAAGGCTGCTCTTATGGCTCTT
CCTGGCCTCAATGAAAAAATTCAAGTGACCCCAGAGAGAAATAAGGATTGGGATTACACT
TGCCCTTCTGGCATTAAGATCTACAACATGAATAAGAAGACTGGTTCATTTGGATTCCCA
ACTTGTTAAGAACTTGCCAATGCTATAGTTCAAAATCTTGATCATGAAAACTCAGCCATC
GAAAAAGTAGAACTTAAGCAAGCTGGTGCAGGCCCTGCAGATAAAGCTGGTTTCTTCTTG
AATATCTCTTTGAAGAACGAGTTTATCGAGAATGAAATCATGAAGATATTACATACTGAG
CAATTGAGTGTGCAAAATGATGAAGAAGAGGAGGCAAAGAAGCAAAGAGTAGTTGTTGAC
TTCTCTAGTCCTAACATCGCCAAAAATATGCACGTAGGACATTTGCGTTCAACTATTTAG
GGCGATAGTATCTGCCGTGTGTTAGAGTTCCTAGGGTATGATGTCCTCCGTACTAATCAT
CTTGGAGATTGGGGCACTCAATTTGGTATGCTTATCACTGAACTAAATGACAAGTTCCCA
AATATGTAAGCTGAAGGAATTGATATGGGTGATCTACAGACTTTCTATCAAAATGCCAAA
AAGAGATTCGATGAGGAACCAGAGTTCAAAAAGACTTCTCAACTTAATGTAGTGAAGCTT
TAATCCGGTGACGAAGATTGCGTGAAAGCTTGGCAATATCTTTGCGAAGTATCCCGTAAA
GAATTCCAAAAAATCTACGAGAGATTAGATATTCGCATTGAGGAACGAGGAGAATCTTTC
TACAACCCTCTTCTTAAACCATTAGTTGAGGAAATGGAAGAGCGCGGTTTCATTAAGGAA
GATAAGGGGGCTAAGTGTATCTTTATTCCAAAGTAAAAGATTCCATTGATGCTTCAGAAA
AGCGATGGAGGTTTCAACTACGACACCACTGACTTAGCTGCTCTTCGTTTCCGTATTAAC
GAGCAAGGAGCTGACTGGATCATCTATATCACAGATTGCGGTCAAGAACTCCATTTCAAG
CTTGTATTTGAAGGCGGTAAAATCGTTGGAATTTATGACCCAACCAAGACAAGAATTGAT
CACATGGGCTTTGGATTAGTTCTTTAAGAATCTACATATGATTACGAAGAAGAAAAGAAA
GAAGGTTAGGAAGAGACAAAAGAAATAAAGAAAGAGTAAATCAAGGAAGAGAAAAAGGAA
GAAACTAAAGCTGCACCAAAGAAGAAGAAGGTTGAAAAAATAAAGACTCGTGAAGGAAAA
AGTACTAAACTTGAGGCTCTACTAGATGAGGCCAAGAACCGTGCCCTATAGATCTTCAAG
AATCGTAACGAGGAGCATCAACTAGAAGGCGCTGAAGCAGTTCATAAAGTACAAGTTGAG
GACAGCGATCTTGAGAAGACAGCTGAAATTTTAGGTATCTCATCTATCAAGTACTACGAC
TTAAAGTAAAACCGTATTCAAAACTACGTCTTCTCTTTCGATAAGATGCTTGACCCTCGT
GGAAATACCGGAGTTTATTTACAGTATATGTACGTCCGTGTCCTTTCCATCATGCGTAAA
GGTAACTACACCCCAGACAAGATTCATGAACTCATGTAAAATGACAAATTCGTCATTACT
TCCAAATCTGAGAGAGAACTTGCTTTGACACTCTTGCGTCTTCCAGAATAAATTGACTTG
GCTCTTACTGATTTGCAACTTAACCGTTTGACCGAGTTACTCTATGAGACAGCTGTTAAA
ATTGGAGAGTTCTATCAACAAAACAAGGTTATTGGTTCTCAAGAAGAGAAATCACGTATC
CTACTTCTTGAAGCTACTCGTAAAGTCATGCTTCAAATCTTTGGACTTCTTGGAATGAAG
ACTATTGAAAGAATTTGA


>Contig21633.0.g19(protein)
MLSLPKHLGGIIGKAALMALPGLNEKIQVTPERNKDWDYTCPSGIKIYNMNKKTGSFGFP
TCQELANAIVQNLDHENSAIEKVELKQAGAGPADKAGFFLNISLKNEFIENEIMKILHTE
QLSVQNDEEEEAKKQRVVVDFSSPNIAKNMHVGHLRSTIQGDSICRVLEFLGYDVLRTNH
LGDWGTQFGMLITELNDKFPNMQAEGIDMGDLQTFYQNAKKRFDEEPEFKKTSQLNVVKL
QSGDEDCVKAWQYLCEVSRKEFQKIYERLDIRIEERGESFYNPLLKPLVEEMEERGFIKE
DKGAKCIFIPKQKIPLMLQKSDGGFNYDTTDLAALRFRINEQGADWIIYITDCGQELHFK
LVFEGGKIVGIYDPTKTRIDHMGFGLVLQESTYDYEEEKKEGQEETKEIKKEQIKEEKKE
ETKAAPKKKKVEKIKTREGKSTKLEALLDEAKNRALQIFKNRNEEHQLEGAEAVHKVQVE
DSDLEKTAEILGISSIKYYDLKQNRIQNYVFSFDKMLDPRGNTGVYLQYMYVRVLSIMRK
GNYTPDKIHELMQNDKFVITSKSERELALTLLRLPEQIDLALTDLQLNRLTELLYETAVK
IGEFYQQNKVIGSQEEKSRILLLEATRKVMLQIFGLLGMKTIERI