Identifiers and Description

Gene Model Identifier

Contig22014.0.g15

Standard Name

RANBP17b

Aliases

Contig22014_0_g15

Description

Importin-beta N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam03810 ) Importin-beta N-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22014.0.g15(coding)
ATGGATGCTCAGACTCAATAAGAACTCGAATATTTTGAGGGCCTATGTCATTAATTGTAT
TCTCATTAAACTGATGCAAAGGCCAAATAGTAAGCAGATCAGCAACTCAAATAGTACACA
AGCAGCATTGAAAGAGTTCCTATGCTCCAGAAATTTCTAACTTTCTCTTCAATCGATTAT
GTTCAGTATTTATCTGCAAGCTCTTTGAAAAATTTGTTGACTGAGAATTGGGATAAAATT
TCATTCGATTCAAAGTTCAATATCAAGTTCTACATTTTGAATTATTTATGCGGGAAAGCT
CTTTAGCAAGATAGATAAGTTTTAAATATGATGATGGCTTTGCTTGCAAAAATACTTAGA
TTATCATGGTTTGATCTGCCAGATATGCAAATCTCAATAGTAGAACTCAACAAACTTTTC
GAAATTTCTGAAGAGCATGTCTTGGTGGCACTTCTAACTCAAGACTAAATTATAACAGAA
ATGACTTATAGTTACAAAGGCAAATAGCTTTCTGTTCATAGAAGAATATCAATGAGTTTC
AGAGAGCATTCACTTATCTTTATGTTTGAGAAATGTCTCAGTCTTATATAGCAAATTATC
AATCAATTCTAGAAAGACTAGATCAATGGGGTAAGAAACAGAGAAATCTTAGAACAAACT
CTAATGATGTGCCTAGAAATCTGTCAAAAAAGTTTAAACTTTGACTGTACCTCAATCATG
CTCAACGATACAATCGAAGAAAATTCTAGCACAAATTTACCACTAACTTGGGCAAAGTTT
GTCAAGGATAAAAGCACCACAGCCAATATGTTCAACTTGCTATTCCTTCAGTTTCAGTCG
AACTAATTCAAAGAAAAAATCAAGTTGCTTGCTCTACAGTGTGCAGCTGATTTTGCAAAT
GTACGACATAATGTCTTCGATTCTTTTGAAGATAGAGCCTAATATTAGCAAGATATCGCT
ACTTTGATTATCAATACTCTCTCTGTTGAGTCTATTGAGCAGTAGATACTCTCACAACCA
AAGCTCCATAGAGAGTTTGTGAGATTGCTAAAGAACCTTGAGTCAAACTTTTCAACAAAA
GATTTCTTTACAAATCGTGACGTGAAACTTTTTGAAGCTTATATTGAAAAACTATTTAGC
TTCACTCTTAAGACTTTAAAATCTAAGAAAACTTCAATCACCAATCAATTAGGAACTCTT
TTCAATATTTGGTTGAAGACTAGAAACTACTCATTATAAAACAGTGTAAGCTCTCTTGGA
ATAATTGAGAATTATGTGCAAATTCTATTGTAAAATTATATTGAGGACAATCTTGAAAAA
CTACTTCATTCTTCAGTTATATCAGAGGAGTCTGATGATGAAGAAGCAGATGACGACGAA
ATTGAGAAATATGATAAGTCAGAGGAATGCAACTAGTCCACTATGATTGAAATCATCTCA
AGATTAATGAGAACTAAAATAGAGTTGTCTATGCAGCTCCTACTTCAACATTTCTTTATA
ATCTAGACTAACTATGAAATGGCTATCTAATAAAAAGAAGATAAAAGTCGCTTGATTTTT
GAAAAGCAGCTCGCATTTCTCACAACTTATGCTTCTGGCATGTTTATGTTTGGAATGCAT
TCTGTGAACAATAGACATCACTGGTACTAATCTCCCTCAGTCTAAGCTATGACCACTGAA
AATGGTATTGCAAACTATATGGACTTCTCTATCGTAGCTAAAGTTATATACTGTCTAAAC
CTATCCATTCGTTCTGTAAATTTAGACAACAATTCTAAAACTTGCAATAAGCTCAATTTA
GCTTTCGTGAAATTCATGAATGTATTTAGACAGCATGTGCTGGGAGATTCAAGAGTCCTT
AGTATTGCAAGATAGATTGATTCATTATAAAATCCAAAATCACTTGAAGATACCACAGAA
GAGTCAGCAGAATAAGAGTCAATGAGAACTCATACAGCATTGGCTATTATTCTCGGATAG
AATGATATGATCAGCATTATTGATGCATTTATTGAGAAATTGCTGCAAATTCTAATATTT
ACTAATACACAATAAGAACTTGGCAAACTAGCTGTTGAAGAGACTCTTACAGTATTTGAA
ATATTTCTTAATTCAAGTATAACAAACAAAATTCTTGGAATGTGTCCAATAGTTCAACGT
TTTGTTTCTGAAACAGTGCTTCAATTTAACTTATTCTAACACGAAAGAGATGCTAAGTTT
CTGGTAAGGTTTTTCCGCATTATCTCCTCTGTATGGGTGAATCAGCAGTACATAAGCAAC
TTCGACACTTATCTATCCCAATTAGGCTAAATTATAACATAAATAACTTAGCTAAATGAT
CCTTCACTACTTAAGTCCCCAGATGTTAGACAAAACATTATCAAACTGTACAGGATTTTA
AGAGGCACTGCAAGTGGGCTTTATCTTGTCTATGACTACAATTTGTTTATGGAATGGTTG
AACCCTAATCAATTTGAGATTACCAAATAAATCATGTCACTCTATATAAATGACGATGAT
GTTTGTTTGGAGATCCTTAAATTTTATAAGGAAATTACTCAAAACAAAAGTACAAGATTG
AAGATAGGAGAATGGGACATAAATGGCATGATAGTGTTTAAGGAGGCGAGTACTATGATT
ATAAACTACTGCAAAGCCTATGATTGCATGAAGAATAAAGTATGTAAGAAAGATATTTAT
GATGAGAAGTTGAGATTGATCAATATCATTTTAAAAAGCTTTCATAATATAATCACAGGA
AATTACCTATGCTTCAAGTATTTAGAGTTTTACAACGACAACACGTTTATATAACTTTCA
TTGCATGTTTTTGAATCTACTTTGGCACTATCCTGGGACTAAGTTAAACCTTATGAGAAA
TTCAACAAGAAGGCACTAACTGTAATAGAACTATTCGTGAGAAATTACACAGAAATCCTA
TTCCTGAATTTCACTTCAGCCACTATTTGGAAACTTCTAGACATGCTTTACATTTTAGAC
CATTTCAACGAGTATATTTACAGCAATTTACAAAAGCCATCAAAGAGATCACCTATATTA
TACGAAACCATTAAGAATTTCCACACCACATAATAGCCAACTTTTTGTCATTTGTTAAGG
ACTCTAGTTTACACTCTAGTGTTTGAGGATCACAAAGAACTACATAACTACAGCAAATGC
TTCCACTCATTGTATATTATGTGTGAGTAAGATGGAACCAAAGTGATCTATGATGCTTTA
CTCTAAGAGGAGAAGAACGAAAAGAGGCAACAGAGAATTTGTGAAGAAATGATGAAGTTA
TTAGAAAATGTGCCCAATGGTCTCGAATAAAAACTCAGAAACATCTTTAATGGCAAGTAT
ATAGTTTTCAAAAATTTCCTGCTAAGCGATACCTTATGA


>Contig22014.0.g15(protein)
MDAQTQQELEYFEGLCHQLYSHQTDAKAKQQADQQLKQYTSSIERVPMLQKFLTFSSIDY
VQYLSASSLKNLLTENWDKISFDSKFNIKFYILNYLCGKALQQDRQVLNMMMALLAKILR
LSWFDLPDMQISIVELNKLFEISEEHVLVALLTQDQIITEMTYSYKGKQLSVHRRISMSF
REHSLIFMFEKCLSLIQQIINQFQKDQINGVRNREILEQTLMMCLEICQKSLNFDCTSIM
LNDTIEENSSTNLPLTWAKFVKDKSTTANMFNLLFLQFQSNQFKEKIKLLALQCAADFAN
VRHNVFDSFEDRAQYQQDIATLIINTLSVESIEQQILSQPKLHREFVRLLKNLESNFSTK
DFFTNRDVKLFEAYIEKLFSFTLKTLKSKKTSITNQLGTLFNIWLKTRNYSLQNSVSSLG
IIENYVQILLQNYIEDNLEKLLHSSVISEESDDEEADDDEIEKYDKSEECNQSTMIEIIS
RLMRTKIELSMQLLLQHFFIIQTNYEMAIQQKEDKSRLIFEKQLAFLTTYASGMFMFGMH
SVNNRHHWYQSPSVQAMTTENGIANYMDFSIVAKVIYCLNLSIRSVNLDNNSKTCNKLNL
AFVKFMNVFRQHVLGDSRVLSIARQIDSLQNPKSLEDTTEESAEQESMRTHTALAIILGQ
NDMISIIDAFIEKLLQILIFTNTQQELGKLAVEETLTVFEIFLNSSITNKILGMCPIVQR
FVSETVLQFNLFQHERDAKFLVRFFRIISSVWVNQQYISNFDTYLSQLGQIITQITQLND
PSLLKSPDVRQNIIKLYRILRGTASGLYLVYDYNLFMEWLNPNQFEITKQIMSLYINDDD
VCLEILKFYKEITQNKSTRLKIGEWDINGMIVFKEASTMIINYCKAYDCMKNKVCKKDIY
DEKLRLINIILKSFHNIITGNYLCFKYLEFYNDNTFIQLSLHVFESTLALSWDQVKPYEK
FNKKALTVIELFVRNYTEILFLNFTSATIWKLLDMLYILDHFNEYIYSNLQKPSKRSPIL
YETIKNFHTTQQPTFCHLLRTLVYTLVFEDHKELHNYSKCFHSLYIMCEQDGTKVIYDAL
LQEEKNEKRQQRICEEMMKLLENVPNGLEQKLRNIFNGKYIVFKNFLLSDTL