Identifiers and Description

Gene Model Identifier

Contig5930.0.g31

Standard Name

RANBP

Aliases

Contig5930_0_g31

Description

RanBP1 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001580409.00228338670803e-35RanBP1 domain containing prote
in
SGDYDR002W2.0009605191578312e-25YRB1 SGDID:S000002409, Chr IV
from 453045-453650, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5930.0.g31(coding)
ATGGTAGAATCACAACACGACGTCGACTACGCTGATCCAGATCAAACCACTCACAACCAA
ACTGAACTCCCAGAGGTCAAGAAAAACACTGGAGAAGAGCTCGAAGAGTGCATCTTCAAG
ATGAGATCCAAGCTCTACAGAAAGAGAGATGAGCAGTTGAAGGAACGTGGAACTGGTAAC
TGCAAACTCTTGAGAAACAAAGAAACTAAGAAGATTAGGTTCGTCATGAGACAAGAGAAG
ACTCTCAAGCCAGTTGCAAACTTCATCTTGCAAGAGTCACCTTTGTGCGAACTTATGCCA
ATGAAGAATAGTGACAAGGCTTTCATCTGGTCATGCAACGACTGCTCAGAAGAAGTTAAG
CTCGAGCTTTTAGCAATTAAGCTCCAAACTGTTGAAAATGCTCTTAAGTTCAAGGAGGCT
TTCGAAGCTGCCTAGAAGTACAATGTATTGTTGAAGGAGGGCAAACTTGAGGAACTTGTT
CACGCTCCCGCCATCGAGGACGTTGAGGAGAAGCCAGACCCAGCAGACGACCCAGACCAA
AATAAGACTGCCGGAGGAGAGGAAGATGGTGCCAACGCTGGTGGAGATGACGAATGA


>Contig5930.0.g31(protein)
MVESQHDVDYADPDQTTHNQTELPEVKKNTGEELEECIFKMRSKLYRKRDEQLKERGTGN
CKLLRNKETKKIRFVMRQEKTLKPVANFILQESPLCELMPMKNSDKAFIWSCNDCSEEVK
LELLAIKLQTVENALKFKEAFEAAQKYNVLLKEGKLEELVHAPAIEDVEEKPDPADDPDQ
NKTAGGEEDGANAGGDDE