Identifiers and Description

Gene Model Identifier

Contig9128.0.g26

Standard Name

RAE1

Aliases

Contig9128_0_g26

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER107C6.002971818577897e-50GLE2 SGDID:S000000909, Chr V f
rom 374545-373448, Genome...
T. thermophilaTTHERM_012172007.99757109788212e-31hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9128.0.g26(coding)
ATGTGGGGTTCAAATACAGGAGGAGGCTATGGCGCCAATACAAATGCAGCTCCAGATGGC
ACTCAATTTGATAATGAAATTCAACATCCATTTACTGATGCTATTTCATGTATGAAGTTT
GCTCCTATCAATCAAACTTACTAGCAAATCGGATCACCAATTCTTGCTGTTGCTTCATGG
GATGGAAATATCGTAATTTATCGCACTCAAGATGATGGTAAGGTTATTCAAGCCCAATTC
ATGCTTCAAACCAATGCTGGCGGGCCTGTTCTCGGAATTTGTTGGTAGCCAGATGCTCAG
GCATTGTTGATTGCATGTGCAGATAACAACATCAAGAGATGGGATCTAGGATAGAATTCT
GTGAATGTTGTAGGTCAACATACTCAGCCTGTTAAGGATATCTACTGCTTCAGCATAAAC
AACAAATCAATAGTAGTTTCTGGAGGGTGGGACTCAAGAGTTAAATTTTGGGAATGGAAC
CAAGGATATCAGGGTCTCAACCAAATTGGAGAGACTTACGTTGCAAAACCAATTCACTAC
ATGAGTGGGGAATTCCCTCTGCTTGTGACTGCTCATTCAGAACTCTTTATTCACTATTGG
AATTTGAACAACATAACAAGAGGGGATTTCAATCCTGCAGGTTTGATAAATTCTCCCTTG
AAGTATGGAACAACAGCTATTGCTTGTTTCCCTGATGCCAAAGGTTTTGCAATTGGGTCT
ATTGAAGGCAGATGTGGGATTAAGTATATAGATGTATAAAATAACAACACAGTCAATAGC
GATGACTTTTGCTTCAGATGTCATAGACAAGATGATACAGCAACCTCAAATCCAAAACCC
TCTCAAGTTTACGCTGTAAACGGCATCGTCTTCAACAAGCAGTTTGGATCTTTTGCTACT
ATGGGGCAAGAAGGAAACTACTTCTTCTGGAATAAAGATTCGAAGAGCAAACTTAAGAAC
ACGAAAGCTTTAACTCCAGCTCTTCCAGTAACCTGTGGCGACTTTCTTGAGAATGCTCAA
CAATTTGCCTATGCATATGGATACGATTGGGGAAAAGGAGCAGAAGAGTCTAAGAAGGGT
TATCCAGTAAAGCTAGTCATTAGAAAAGTTCAAGAGAGTGAAGTCATTAAGAAAAAGCCT
TGA


>Contig9128.0.g26(protein)
MWGSNTGGGYGANTNAAPDGTQFDNEIQHPFTDAISCMKFAPINQTYQQIGSPILAVASW
DGNIVIYRTQDDGKVIQAQFMLQTNAGGPVLGICWQPDAQALLIACADNNIKRWDLGQNS
VNVVGQHTQPVKDIYCFSINNKSIVVSGGWDSRVKFWEWNQGYQGLNQIGETYVAKPIHY
MSGEFPLLVTAHSELFIHYWNLNNITRGDFNPAGLINSPLKYGTTAIACFPDAKGFAIGS
IEGRCGIKYIDVQNNNTVNSDDFCFRCHRQDDTATSNPKPSQVYAVNGIVFNKQFGSFAT
MGQEGNYFFWNKDSKSKLKNTKALTPALPVTCGDFLENAQQFAYAYGYDWGKGAEESKKG
YPVKLVIRKVQESEVIKKKP