Identifiers and Description

Gene Model Identifier

Contig22030.0.g96

Standard Name

RAD51c

Aliases

Contig22030_0_g96

Description

Rad51

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001423307.996279467593648e-176DNA repair protein RAD51 conta
ining protein
SGDYER095W8.003772709196459e-140RAD51 SGDID:S000000897, Chr V
from 349980-351182, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22030.0.g96(coding)
ATGAAATAAGCAGAAAAAGAAGACGTCGCACAGCAGGAGGAAGAGGAAGTAGAGTTAGAA
GGACCCACTCCAATTAAAGCTCTCGAAGAAAAAGGTATTAATGCAGGTGATATAAAAAAG
CTGGAGGAAGCTGGATATCATACTGTAGAAGCTGTGGCCTTTACTCCAAAGAAAATGCTC
ATAAACGTTAAGGGTCTTAGTGAGGCAAAGGTCGATAAAATCGTAGAAGCAGCTCAGAAA
ATAGTCAATTTAGGGTTTCAAACAGCCTCCACTTACTTCGAAAAGAGATAGAGTATGGTT
CATCTCACAACTGGCTCTTCATCGCTAGATTAATTACTTGGAGGAGGTATAGAAACAGGC
TCTATTACTGAGATTTTCGGTGAATTCAGAACTGGTAAAACGCAAATATGTCACACTCTC
TGTGTAACTTGCCAACTTCCAATAAGTAAAGGTGGTGGAGAAGGAATGGCAATGTATGTT
GATACCGAGGGTACCTTCAGACCAGAGAGATTGATACCTGTAGCTAAGAGATTCGGATTA
GATGAGCAGCAAGTTCTTGACAATGTGGCCTATGCTAGAGCACATAACACCGATTAGCAA
AATAAATTGCTTATCTAAGCAGCTGCTCTAATGGCAGAGAACAGATTTGCTCTCCTCGTT
ATAGATAGTGCAACTGCACTTTATAGAACAGATTACAGTGGTAGAGGTGAGCTTTCGGCA
AGATAAATGCATTTGGCCAAATTCTTGAGAACCTTATAAAGAATTGCAGATGAATTCGGT
GTTGCAGTAGTAATAACAAATTAAGTGGTGGCCTAGGTGGATGGTTCAGCTATGTTTGCA
GCTGACTCTAAGAAGCCTATCGGAGGTCATATTATAGCTCATGCTTCATGTACCAGATTG
TCTCTAAGAAAAGGAAGAAATGAGAGCAGAGTGTGCAAGATTTATGACTCTCCTTGCTTG
CCAGAATCTGAGGCTATGTATGCTATAACAAATGATGGAATCGATGACTATAAAGACTGA


>Contig22030.0.g96(protein)
MKQAEKEDVAQQEEEEVELEGPTPIKALEEKGINAGDIKKLEEAGYHTVEAVAFTPKKML
INVKGLSEAKVDKIVEAAQKIVNLGFQTASTYFEKRQSMVHLTTGSSSLDQLLGGGIETG
SITEIFGEFRTGKTQICHTLCVTCQLPISKGGGEGMAMYVDTEGTFRPERLIPVAKRFGL
DEQQVLDNVAYARAHNTDQQNKLLIQAAALMAENRFALLVIDSATALYRTDYSGRGELSA
RQMHLAKFLRTLQRIADEFGVAVVITNQVVAQVDGSAMFAADSKKPIGGHIIAHASCTRL
SLRKGRNESRVCKIYDSPCLPESEAMYAITNDGIDDYKD