Identifiers and Description

Gene Model Identifier

Contig20641.0.0.g16

Standard Name

RAD51b

Aliases

Contig20641_0_0_g16

Description

Rad51

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001423304.0013667688777736e-172DNA repair protein RAD51 conta
ining protein
SGDYER095W2.000851114308011e-136RAD51 SGDID:S000000897, Chr V
from 349980-351182, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20641.0.0.g16(coding)
ATGCAAGCTGAAAAGTCTAGAGGAAAGTAGAAGAAACAGGAAGTTGTTGAAGTTGCTCAG
TAGCAACAGCAAGAAGATTCAGAGATGGAGGAGAATGATGGACCAACACCTATTATGAAG
CTAGAAGAACATGGCATTGGAAGCGGAGACATTAAGAAACTTATTGAAGGAGGCTATCAC
ACACTTGAATCTGTAGCATTCATGTCAAAAAAACATCTTGTCTTGGTAAAAGGTCTATCA
GAGGCTAAAATCGATAAGATTTTGGAGGCTTGTCACAAACTTGTACACATGGGATTTTAA
ACAGCAGGAACATACCTTGAGTAGAGAAAGGATTTGGTCTTTCTTTCAACTGGTAGTAAA
GGTCTTGATACTTTGCTTGGTGGAGGTATGGAAACAGGATCAATCACAGAGATCTTTGGT
GAGTTTAGAACTGGTAAGACTCAAATATGTCATACTCTGTGTGTTACTTGCTAACTGCCA
GTTAGTCAAGGTGGAGGTGCTGGTATGGCAATGTACATCGATACAGAGGGTACTTTCAGA
CCAGAGAGACTTATACCGATTGCCAAAAGGTATGGATTGGATGAGCAAAAGGTTTTGGAC
AATGTTGCTTATGCTAGAGCTCATAACACTGATCAGCAAAATAAACTTCTGATGTAAGCG
GCAGCATTAATGTGCGAAAGCAGATTTGCTCTTCTTATTGTTGACAGTGCAACAGCCCTC
TACAGAACAGATTACTCTGGAAGAGGAGAACTCTCTGCTAGATAGATGAGTCTTGCCAAG
TTCTTGAGATAACTCCAAAGATTAGCTGATGAATTTGGAGTGGCTGTTGTCATAACTAAC
TAAGTTGTAGCCTAAGTTGATGGAGCATCTATGTTTGCAGCTGATTCAAAGAAACCTATA
GGCGGGCACATCATCGCTCATGCAAGTACAACTAGACTTTCCTTGAGAAAAGGTAGAAAT
GAGAGCAGAGTCTGCAAGATCTATGATTCTCCATGTTTGCCTGAGGGAGAAGCAGTATTT
GCTATCACAAATGACGGTATTGATGATTACAAAGAGTGA


>Contig20641.0.0.g16(protein)
MQAEKSRGKQKKQEVVEVAQQQQQEDSEMEENDGPTPIMKLEEHGIGSGDIKKLIEGGYH
TLESVAFMSKKHLVLVKGLSEAKIDKILEACHKLVHMGFQTAGTYLEQRKDLVFLSTGSK
GLDTLLGGGMETGSITEIFGEFRTGKTQICHTLCVTCQLPVSQGGGAGMAMYIDTEGTFR
PERLIPIAKRYGLDEQKVLDNVAYARAHNTDQQNKLLMQAAALMCESRFALLIVDSATAL
YRTDYSGRGELSARQMSLAKFLRQLQRLADEFGVAVVITNQVVAQVDGASMFAADSKKPI
GGHIIAHASTTRLSLRKGRNESRVCKIYDSPCLPEGEAVFAITNDGIDDYKE