Identifiers and Description

Gene Model Identifier

Contig15858.0.g53

Standard Name

RAD51a

Aliases

Contig15858_0_g53

Description

Rad51

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004592303.001003044337619e-17hypothetical protein
SGDYDR004W0.00000000000009996062864481225RAD57 SGDID:S000002411, Chr IV
from 455201-456583, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15858.0.g53(coding)
ATGGAAGGAAATTTCTTTTTGTTCAACAATCCAGCTGCAAACAACTAATTCAACTAAAAC
CCACACTAGATGGATTAGTAGTTTGATGCAAGTGGCTAATAATTTAATCCTGATCTTTTG
GGTACTGAACCTGCAAATATCATGATCACCAATTGCTTTGAATTGGCTTAAAGACCAGAG
ATAAGGCTCAGTTCTGGATGCAAGATTATCAATGATTTCTTGAGGGGTGGATTTCTGTCA
AAAAGATTGTACGAGATTTATGGAGAGAGTGGTTCAGGAAAAACTTAGCTTGCCATTCAA
CTTATGCTAAACTCAATTTTACCACTGAAAAACGGGGGACTTGGCGGAAAATCTCTGTTT
GTAATTACTGGCAAACATTTAAATGAAAAAAGATTCAATGAAATGAAAGAGTATTTCTTG
ATCGAACATTAAGGACTAACACATGAAAATGCAGTGAAAGACAACATTATTATGAATTAC
TGTAAAACCATTGAAGAATACAACAAAGTATTCCTTAATCTAGTGTCAAGAATATAGCAA
GAAAATGTGAAGCTTGTAATTATTGATAACATACACAATGTCTGCGACAATTTTATCAAA
TCAGAAGGCTCAATTGACTTTTTGGAGAGAAGTAGATTTATTTAAAAACACTCAAAGCTT
TTGAAAAAATTGGCATACTAATACGATCTGACTATTATTTTAATGAATAATGTAGTAGCT
GATGTGTCTCAAGATAACTCTTCAAAGGGATTCTTCGATGGAAAATCAAGAGGATAGAGC
ATTACTCCTTCTTTAGGTTTACAATGGACGAACTGCATTAATGAAAGAATTCACTTGAAG
AAAAAGGGTACAAATGCAGACAATATCAGAAGAACAATAGTAATTGATAAAAGCTCATAC
ATGAGAAAATCAGAGTTAGATTTTGAAATTATTAATAACGGTATCAGAGGCAAGCATTGA


>Contig15858.0.g53(protein)
MEGNFFLFNNPAANNQFNQNPHQMDQQFDASGQQFNPDLLGTEPANIMITNCFELAQRPE
IRLSSGCKIINDFLRGGFLSKRLYEIYGESGSGKTQLAIQLMLNSILPLKNGGLGGKSLF
VITGKHLNEKRFNEMKEYFLIEHQGLTHENAVKDNIIMNYCKTIEEYNKVFLNLVSRIQQ
ENVKLVIIDNIHNVCDNFIKSEGSIDFLERSRFIQKHSKLLKKLAYQYDLTIILMNNVVA
DVSQDNSSKGFFDGKSRGQSITPSLGLQWTNCINERIHLKKKGTNADNIRRTIVIDKSSY
MRKSELDFEIINNGIRGKH