Identifiers and Description

Gene Model Identifier

Contig20622.0.g13

Standard Name

RAD51L

Aliases

Contig20622_0_g13

Description

Rad51

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER179W1.000361553249356e-16DMC1 SGDID:S000000981, Chr V f
rom 548421-548552,548645-...
T. thermophilaTTHERM_001423300.00000000000001000191320216021DNA repair protein RAD51 conta
ining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20622.0.g13(coding)
ATGGATTGTCTAAATGTGAGTTTCTTGAACGTGAGTAAGCAAATAAGAGGAATATTAATT
CACAGTGGATATTTGACTGTGGCTGATTTACTCAAGTATTATGAAAAGCTAGACAGACTA
AAAACAGAACCAGCTCTATAGAATGATTAACTAGAAGGTCTAAAATTAGAATTACAGAGA
ATTAAAAAATTGTCAGAGTAACTAGACAAAGAAAACCCACTTGAATTTTCTTTAAGCATA
AGAGAAAACCAGAAAGATGAGGCACTTCTACAAAAAAGAAAAAAGATTTACTTAATGAAG
GAGTTGCAAGTGATAAGATCTGGTCCTGGTTACGGTGGAGACAACGAACATGAAGACAAT
TTCTTCGATGAAATATTTGGATTAGGAGAAACAACAGAAATTTGTGGGTTATCTGCAACT
GGTAAAACTTAAGTATGTTACTAACTCTGCATGAATGTGTAAATTCCAAAGGAACTAGGT
GGTGTAGATGGAGAGGCACTTTTTGTAGATACTCATGGTGATTTTGCAATAGAACGCATA
AAAGAAATGGCGAAGTCATTACGTTAACAAGTCCTTAAGAAAATAGAGAAGGAACCTAAT
CTTAGCAAAAAATACAAAGAGGAGTTCTCATTAGATCGAATTCTCTAGAAAATAAGATAT
GTCAGGCTTTTGGATGAAGCTTAGCAGCTGCTCTTTCACAATTAACTCGAAGATAAACTC
TTAAATTCCAACTTATCTAAGGTTAAGCTTATAGTCTTTGATACTTTCAGTGAGCATTTC
AGGCTTGCAGAATTAAGTTATAATGATAAAAAGAGAGTCATTTCTTAGGCTTTAATGAAC
TTACTGGAACTCGCCTAGAGATTCTAAATATGCGTGGTTTTTATCAATAACATGAAAACA
GCCAAGAAGGAATTCTTAAGTGAAGTGAGCGGAGGTATCGGCAGTGGTATCTCAGGCATG
GGAATGGGAAATTCAGGGCCAGGCTTAATGTATTAACAAAGCAAGCCAGAAGCTATGTTT
GGGGAGGACATGTTTCAATGCGTCACTAACCGCATTCAACTGGAGAAAGATCATAATATA
TCTGAGGAAAATATCATAAAGGGGAAGTTAATTAAGGGAAGTATTGCTAATTTGTAGAGT
ACAAATACTTGTCATTTTCAGGTTTTGGAAAAGGGTATTACAACTATTTTGTGA


>Contig20622.0.g13(protein)
MDCLNVSFLNVSKQIRGILIHSGYLTVADLLKYYEKLDRLKTEPALQNDQLEGLKLELQR
IKKLSEQLDKENPLEFSLSIRENQKDEALLQKRKKIYLMKELQVIRSGPGYGGDNEHEDN
FFDEIFGLGETTEICGLSATGKTQVCYQLCMNVQIPKELGGVDGEALFVDTHGDFAIERI
KEMAKSLRQQVLKKIEKEPNLSKKYKEEFSLDRILQKIRYVRLLDEAQQLLFHNQLEDKL
LNSNLSKVKLIVFDTFSEHFRLAELSYNDKKRVISQALMNLLELAQRFQICVVFINNMKT
AKKEFLSEVSGGIGSGISGMGMGNSGPGLMYQQSKPEAMFGEDMFQCVTNRIQLEKDHNI
SEENIIKGKLIKGSIANLQSTNTCHFQVLEKGITTIL