Identifiers and Description

Gene Model Identifier

Contig17805.0.g2

Standard Name

RAD50

Aliases

Contig17805_0_g2

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYNL250W1.0000099287337047e-53RAD50 SGDID:S000005194, Chr XI
V from 175410-179348, Gen...
T. thermophilaTTHERM_007737903.9998411574835458e-50hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17805.0.g2(coding)
ATGTCGTCAATCGAGAAACTTGCAATCAGAGGAATCAGGAGCTTTTCACCTTTTGATGAA
GAAAAAATTGAGTTTTATAAACCCTTAACTTTAATTTTGGGGCAAAATGGAGCAGGTAAA
ACTACAATCATTGAAAGTTTGAGAACAATGACATCTGGATCCATGCCACCTCATACTTAG
GGAGGAAAGACTTTTATTCATGATCCAAGAATTTCAAATTAACCTGAGACCAAAGCTTCC
ATAAAACTTGTCATTAACACTATCAAAAACAAACCAGTTTTTGCTATGAGAAGTTTTCAG
TTGATGAATAAAAAGCAAAAGTAAGAATTCAAAAAACTCGAGTAAGTATTGAAAGCAAAA
GACGAGAGAACTGGCCAGGAGATTAGTATAAATAAAAACTGTGCTGATATGGATAGACAC
TTGCCACTTCTTATGGGTGTATCTAATGCCATTCTTGAGAATGTCATCTTTTGCCATTAA
GAAGAAAGTTTATGGCCCTTCTCTGACCAAACTAATCTCAAAAAGATCTTTGATGAAATT
TTCGATACCACTAAGTACACCAAAGCCCTAAATGAGATGCGAGTCTCAGCCAAGAAGTAT
TCCAAATATGCCAAAGACTTCAAAACAGAGTTAGACCTTAAGAAGAAAGACTATGAATAG
TATGCTAAGCTAAAATCTAACGTAACTCAATATGACAACAAACTCAGAGAATTGAGGAAT
GATATATCAAATGCATAGGCTAAAAAGGAGCAGCTAGAAAAAGAAAGTCAGGGAATCGAT
AGAGAGCTGTTTTAGATACAGTAAGCCGAAAATGAATACAATTTTCTCAACATGACATTG
AAAGAAAAGCAGAGACAAGCTGAGGATATGAATCAGAGATTTGAATTTGAGGATCTCAAA
AATGGAAGATATACTTTGGAGTAGAAAGAAAGAGAGCTTAATAAAATCAGGCAGAATTAT
GACTCAACCATATAATTATATAAGACTAAGAAGCAACAATTTGAACAAAAGATTGATTAA
TTGAGGCAACAAAGTTCAACTCTTAACTAAGAAATCAACGATATCAGAGCTTCTGCAGTA
ACAAATAAAAAGTAATTGGATGAAAATCTCTCTCAAAAGAATTCATTAATCTCATAAATC
TAGCAAAGAGTAAAAGAATATCAGCCACTTGAAGATTAAAGAAAGTAAAACAAACTTACT
CAAGCTTAAGATCTCAAGATTTCAGAAATAGATTCACTCATAAGCTTATCAAAATTAGCT
CGAGATCAATCTGATTAGCAATCCCAAACCTTAAGAAGTGAACGATAAGAAACCACTTAA
AAAGCTTATCAAAATATCAAGATTGAAGAAACAAAAAAGAGCATTTATGACAAAAACTTA
ACCGATGTAGAACGCTAACTTCAACAAATAAAGAAAAACAAAAGAGAGTCCTCGGATAGC
AATGATAGTAATGAGTTCGAAGAAGAAGCTAATGGCTTAGAAGCTATCGGTAAGAATCTG
TAAACATTAGAAGAGAGGTTGTGCTAGATCAGTTCAACTTTGAAGAAAGATTTTGGAATT
GAGGTTGGAGGTTCACAAAAAAACAATCAAGGGGATAACAATATGCTGAGCAGTCAAGAG
GACTCATACATGTAAATGAAAAACAGCAGAAAGTCCAATTAAAACACTAAAATAGGCTAG
ATAAACACAAAAATAGAGCAGAAAATTTTGAAGAATAAGAAGCTAGATAGCACTATCTAA
CAGATCAAGAAAGATATTGTTGAAATCGAATCAAACATAAAAAATGAAGAAATGTAACAT
TAGAAATATTAAAAGATGCAAGAAAGTTATCAGAAGATGCTTGATATAATTGCAAAAGTA
AATCCTTCTCTTAAGCTTTTGCAAATTGATTAGATAAACAAAAAAGAACTTTCAAAAAAG
AATGATATTGACTTTAAGGAGATCATTTTAGCTGTAAACTAGAGATGTGGAAGTCAAGAG
ACTTTGTAGTTTGCTATAAATGAGCTTAGAACTATTTATAACAAGTTCAATGACAACTTA
AAGCCAGGAGAGTAGAAATAATAGCAAAACCCATCTGTTTAATTAGACAAAATAAGGACC
TCTTTAGATTAGTATGTGAAACAAAAATCACTCTATGATTCTACAAAGGAAACAATAAAA
CGTCTTTACGCCATGACAAAGAAGAAAGATGAAAAGACCAATTAAACTTCTTGCTTTTTG
TGTAAATAAGAGGCTTCATCTAGTATAATCCAGAATATGCACACTAATTTCATATAAAGT
ATGGATAACAACTCTGAGAGATAATAAGAGATAGAGAAGATGAGATCTGATCTCTTAAAC
AACATATCAAATATAAACTAAGCAAGCGAATAGCAAATGTGTGAAGATCATAACTTAAAA
GCTATTCTGGCTGATATTAAAACTCGCATTTCAGAACTTGAATTGCAACAAAAATCATCA
AAAAGCATCAATCAACAAGATCTCTGCTAATCTTTGCTCGAAATTGACTATCTTTACAAA
CAAATGTTTTCATAAGGTAAAATCGAGGATAACACATCTAAGTTAGCTAATTTACAAGAT
AAACTACAAAAGTAAAAATTGGATCTTAACAAGAATGAAAAAGATCTACTTAAAGAATAG
AAAGTTGTTGATTAAATGAAGTAAGAGAAAGATGATCTAGAAAAACAGATGCAGTCCTTA
TAGTTAGAATTTGTTCACTTATAAGCCAAAAAGTATAAGCTTATGTCAAAATCAAAGCAT
CTAAGTATGAGGCAAACTAACAATAACGGAGAATCCATTGAGGAAGAGCTTATGAAACTT
ACTAAGCAAAAAGCTCAATTCGAATAAGAATTAAAGCTAATTAGTGAGAATATTGAAAGC
TATGAATTTGAAATTTTAGAGATTGAGAACAATAGAGAGTAGAAACTTTAAATTGAATCT
TTAGCCAAGAAGTCGTCAAGACTCTCTGAGTTTATTGATATAATGAACAGATTGTATATT
CAATACTAGAATATCTAATCTCAGCTTGAAAAGAATCAGTCACTTTAGGAGCAGCTTGAG
AATGCAGATTTCCAAATTTAAACCAAAACTTAGAAGAAATCGCAGGTTGAAGAAGATATC
AAATTAAATGAACTTGAACTGAGAAGAGTTATTGATGGTATGCAATCATAAGATGAAGTT
GAGAAGATCATAAGTGAATTTGATAGGTATAAATAGTTGAAAAATGCAGTTGTTGATATT
CAAACTTAGATTCTTGATAAGTAGAAGATTATACACAAGAAAAATCAACTGAAAGAACAG
AGAGACAAAATGCAGCAAGAGTTAACAGAAAGCATTTAAACTTACAGCAAGAGTAGTGGT
TACTGCATTTCGATATAGGAAACCTTAAGATCTATGAAAGTAGAACTAATTGAAGAAAGA
TTCGTGGACATAGAGAAAAAGCTCCTAGATCTAGAAATAAAGTACAATTTGACAAAAGAT
ATGGCAATTGAGATATCAGAGAAGCATGATGCTCTTGAAGAAGCGCTTATGAAGTATCAT
TAAGAAAAAATGAAAGAAATCAATAAGACTCTCAGTGACTTTTGGAAGATGACCTACAAA
GGAAATGACATAGACACCATTGAAATCAAATCAGATGATGAGAAATAACCCAATTCTCGT
ATTAGATCCTACAATTACAGAATTGTATTGAAAACTTACGACGATACTGAGTTGGACATG
CGTGGTAGATGCTCTGCAGGTCAGAAAGTTCTATCTTCAATTATAATAAGACTGTCCCTA
GCTGAGACTTTCTGCTCAAATTGTGGAATATTGGCACTTGATGAGCCCACAACCAATCTG
GATGTTGATAACATAGAAGGTTTAGCTGGTGCACTTATTGAGATCATAGAAAGTAGAAGG
AGACAAGAAAACTTCTAGTTGATTATCATCACTCATGATTAACAATTTGTGCAGCTACTC
GGGAGGGAATATGCGGAGTACTACTGGAGAGTGGCTAAGGACAACAGTGGATACTCTAGA
ATTATCAAGGATCATGTTAAAAAGCTATAGTGA


>Contig17805.0.g2(protein)
MSSIEKLAIRGIRSFSPFDEEKIEFYKPLTLILGQNGAGKTTIIESLRTMTSGSMPPHTQ
GGKTFIHDPRISNQPETKASIKLVINTIKNKPVFAMRSFQLMNKKQKQEFKKLEQVLKAK
DERTGQEISINKNCADMDRHLPLLMGVSNAILENVIFCHQEESLWPFSDQTNLKKIFDEI
FDTTKYTKALNEMRVSAKKYSKYAKDFKTELDLKKKDYEQYAKLKSNVTQYDNKLRELRN
DISNAQAKKEQLEKESQGIDRELFQIQQAENEYNFLNMTLKEKQRQAEDMNQRFEFEDLK
NGRYTLEQKERELNKIRQNYDSTIQLYKTKKQQFEQKIDQLRQQSSTLNQEINDIRASAV
TNKKQLDENLSQKNSLISQIQQRVKEYQPLEDQRKQNKLTQAQDLKISEIDSLISLSKLA
RDQSDQQSQTLRSERQETTQKAYQNIKIEETKKSIYDKNLTDVERQLQQIKKNKRESSDS
NDSNEFEEEANGLEAIGKNLQTLEERLCQISSTLKKDFGIEVGGSQKNNQGDNNMLSSQE
DSYMQMKNSRKSNQNTKIGQINTKIEQKILKNKKLDSTIQQIKKDIVEIESNIKNEEMQH
QKYQKMQESYQKMLDIIAKVNPSLKLLQIDQINKKELSKKNDIDFKEIILAVNQRCGSQE
TLQFAINELRTIYNKFNDNLKPGEQKQQQNPSVQLDKIRTSLDQYVKQKSLYDSTKETIK
RLYAMTKKKDEKTNQTSCFLCKQEASSSIIQNMHTNFIQSMDNNSERQQEIEKMRSDLLN
NISNINQASEQQMCEDHNLKAILADIKTRISELELQQKSSKSINQQDLCQSLLEIDYLYK
QMFSQGKIEDNTSKLANLQDKLQKQKLDLNKNEKDLLKEQKVVDQMKQEKDDLEKQMQSL
QLEFVHLQAKKYKLMSKSKHLSMRQTNNNGESIEEELMKLTKQKAQFEQELKLISENIES
YEFEILEIENNREQKLQIESLAKKSSRLSEFIDIMNRLYIQYQNIQSQLEKNQSLQEQLE
NADFQIQTKTQKKSQVEEDIKLNELELRRVIDGMQSQDEVEKIISEFDRYKQLKNAVVDI
QTQILDKQKIIHKKNQLKEQRDKMQQELTESIQTYSKSSGYCISIQETLRSMKVELIEER
FVDIEKKLLDLEIKYNLTKDMAIEISEKHDALEEALMKYHQEKMKEINKTLSDFWKMTYK
GNDIDTIEIKSDDEKQPNSRIRSYNYRIVLKTYDDTELDMRGRCSAGQKVLSSIIIRLSL
AETFCSNCGILALDEPTTNLDVDNIEGLAGALIEIIESRRRQENFQLIIITHDQQFVQLL
GREYAEYYWRVAKDNSGYSRIIKDHVKKLQ