Identifiers and Description

Gene Model Identifier

Contig15291.0.g9

Standard Name

RAD4

Aliases

Contig15291_0_g9

Description

Rad4 beta-hairpin domain 3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008254609.999888128184441e-42DNA repair protein Rad4 contai
ning protein
SGDYER162C0.0000000000005000841553255702RAD4 SGDID:S000000964, Chr V f
rom 502894-500630, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15291.0.g9(coding)
ATGTAAGAGCATGACGATGACAATTAACATGGTGACTTTGAAGATTTATTCGATCATGAG
TAGAGTTATAATAATGTTCAGGATAATAATGAACCAGGTTTTGTTGGCAATAATGATTAA
AATTATAAGTAGAGTAGTAATTTCTTTATGCAAAATGAGGACTATTCCGATGAGGATGAG
AAGCTTTTCGATTAGTAAAATGAAGAAAAAACAGTGGCTAAGATTCAAGAATCTATTGAT
GATTTAATCGAAAAGGGAAAGAAGAGGTCTTTGTAGTATCATGAGTTAATTTAAAGAAGA
GAAACGAAAAAGAGAAGACTAATGCAGCTTGATGAAGCTAAAACTTACTTGCTTTTGAAT
ATTGGGAGAGCTTTTATGTTTAATGCACATTAATTTAACTCAGTGCACAGGGGAGTAGTG
CTTTCGCTTATCCCCATGTAATATCAAGTTAAGTACTTAGATAGAGACTTTGTGAAAATG
GGTCACTAAGCTTAGGTTCTATAAAAAAGTAACATTAATAGTGGATAAAAAAGCAAATAA
GTAGGATTCTCATAATAAATTAGAGATATAATTGCAGAGTTTAATAAGATTTTTGGAAGT
TACCTTGATACATCCAAGGAATGCTTGATGACTAAGAAACAAAACTTCTTAAAAAACCTA
ACAGAAAACAAAAAGCTATCAAAGATAGAATATATGATACTATTTTCGATATTCCTGAGT
CTGCATAAATTAGTGTACAGAGTAAATTTCGTCATTGATATTTCCACTATGGAAGACTCT
AAAGTCATAAAAGTATCAAGAAAAGGCTAAAAAGGGGCTAAACGTAATAATGAGGAATAG
AAATATGGGAGTGAAGGGAAGGCAAATAACGATAAATTCCTATATGGAAGAGCACAATAA
ATCATAAAAGATAAGAAAACCAAATATGATGACCATTTCCTGAATAATAAACTAATGAAC
ATAGTGAGTGAATCTGAGGATGAGAATAAATCATCACTTCATGAATCATTTAAGAGGTTT
AAACTCAATGACGAAAGTGATAATGTGAACAGTAATAATTTGGCAAAAGTTGATGAGATG
ATTGAAGTTAAACATGTTGGTAAACAGAAGGAGGAAATAAAGTAGATAGATAAAAGTTTC
TTTGATAAATTCTCTTTCAAACCATCAAATACCACCAGTGTTACAAAGTAAAGAGGATTC
AATGATAATACTGATGACCATTTATTTAACGATAGACAGAAAAGTACCTAGGGCAATAAA
ACTCAATAGAAAACTTAAAGAATATAGTAAACTCAGACACAAACTTAAAACAGCAGTCAC
TTGAACATAATGAGCGGGAGAGTGTAATAATCAATAATGCCAACTCATTTGTCTAAAGAT
TAAGAACAAATTAGTGATCATTTCTAGTCCCCAACTAAAGACTTGGACATTGCTTTTGAA
GAGAATTTATTTATAGAAATATACGATGAATTGAACCATAGGTGGTCGGTGGCATGTCCC
TTCACTGGGGACTACTATACTACACATGAATAAGTGCAGACTTATATGAGAGTATAGAAA
ACTCTTTTCATCCTATCATCTCAATCCTATAAAAGCTATGAATTTATGAGAAAATAAGCA
TATATCAACAAATCTTAAGATTTCACTATGTTTATGAGAGAAATCGGAACAACATATGTT
CATCATAAATTCATTAAGGATTACTTGAAAGCGAAGAATAGTTGTATCTTGACAAAGTAT
GTGGAAGAATTTGTTGGCAAATTTGCGCCCAGTATTGAGACTTTAGAGCAATCTTTCATT
CCATCGACCACTAATGAATTCAAAAACAATAAATACTACACACTCCCCTCCCTGATCAGG
AAATATTAGGGATTTTTACCGAATGCAGTACCTCTTGATGATAAGACTTTCAAGGGAGAG
CCAATATTCTTGAGGAAGGATATCAGTGAGTTACATACTGTGGAGAGATGGAGGAAGTAT
GCAAGGTAAGTTAAAAGTAAGGAAGAGCCTGTCAAGAGAGTCAAAGGATTGTACAACGAT
CCAGAAAGAATGGCAGAGCTTTATGGATATTGGTAGACTATTCCATGGAGAAATGAACTC
ACAGAAGATGGTAAAATACCTAGAAATTAATATGGGAATATTGAGATTATGAGTGGCCCG
ATACCTGAGGGTACGATCCATATTGACATACCAAAGGCAGCTTTGATATGCAAGAAATTA
GAAATTGATTTTGTACCTGCAGTGATAGGTTTTGAGAAAGGTGGAAATGGTAAGAGTCAT
CCTTGTGTCTCTGGAGTGGTAACTTTTAAGCAGCATCATTAGCAAGTTCTTGATGAATAT
AAAAAGCTAGCAGAACAGTCAAAAAAGAGATAATAAGAAAATATCACTAAGAAAGCCAAG
AAGGCATGGAAAGATTTATTAAGATCGATTTTGGTAAAGAAATATATTTCAAGCACTTAT
GATGTTGGAGAGCAACCTATGAAAGTGTGA


>Contig15291.0.g9(protein)
MQEHDDDNQHGDFEDLFDHEQSYNNVQDNNEPGFVGNNDQNYKQSSNFFMQNEDYSDEDE
KLFDQQNEEKTVAKIQESIDDLIEKGKKRSLQYHELIQRRETKKRRLMQLDEAKTYLLLN
IGRAFMFNAHQFNSVHRGVVLSLIPMQYQVKYLDRDFVKMGHQAQVLQKSNINSGQKSKQ
VGFSQQIRDIIAEFNKIFGSYLDTSKECLMTKKQNFLKNLTENKKLSKIEYMILFSIFLS
LHKLVYRVNFVIDISTMEDSKVIKVSRKGQKGAKRNNEEQKYGSEGKANNDKFLYGRAQQ
IIKDKKTKYDDHFLNNKLMNIVSESEDENKSSLHESFKRFKLNDESDNVNSNNLAKVDEM
IEVKHVGKQKEEIKQIDKSFFDKFSFKPSNTTSVTKQRGFNDNTDDHLFNDRQKSTQGNK
TQQKTQRIQQTQTQTQNSSHLNIMSGRVQQSIMPTHLSKDQEQISDHFQSPTKDLDIAFE
ENLFIEIYDELNHRWSVACPFTGDYYTTHEQVQTYMRVQKTLFILSSQSYKSYEFMRKQA
YINKSQDFTMFMREIGTTYVHHKFIKDYLKAKNSCILTKYVEEFVGKFAPSIETLEQSFI
PSTTNEFKNNKYYTLPSLIRKYQGFLPNAVPLDDKTFKGEPIFLRKDISELHTVERWRKY
ARQVKSKEEPVKRVKGLYNDPERMAELYGYWQTIPWRNELTEDGKIPRNQYGNIEIMSGP
IPEGTIHIDIPKAALICKKLEIDFVPAVIGFEKGGNGKSHPCVSGVVTFKQHHQQVLDEY
KKLAEQSKKRQQENITKKAKKAWKDLLRSILVKKYISSTYDVGEQPMKV