Identifiers and Description

Gene Model Identifier

Contig1462.1.g30

Standard Name

RAD26c

Aliases

Contig1462_1_g30

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR073W1.000159011384939e-43RDH54 SGDID:S000000277, Chr II
from 383112-385988, Geno...
T. thermophilaTTHERM_002374901.999683289470905e-41SNF2 family N-terminal domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1462.1.g30(coding)
ATGATTGATATCGATATTGAAACAGAGAGTGATGATGATCAAGACTCAATACTAATGCAA
TCAATACCTCAATCAGAGAAAAATCTTCAAACTAATATTAAGCAAGAAAAGCCCAATTTC
TCAGTCAATGACTTGTTTGGATGCAAAAACGAAAATCTTATAGGGTAAAAAATGAGAATA
AAAAAGGTAAATTCTGTAGTCAAGAAAGTCTTTGATAGTAAAATTAGGAAGTTTGTTCCG
ATAGAAGAATTTGATTAAAATGCAGGATCTGTGATAAAAGGAAACAAGATTTAAAAGCAG
GAGAAGTAAAGCACTGAAAAAATAAGAGACTAGGATATCGATCTCATTATTGAAAAAACT
CATGAAAGTGAAGATGAAACACTCTATGTGCCATCCTCAGCTTAGAATTTAAGTCCGAAA
AAATTAGCACAAGAAGCTAAGGACTTAAGTATAGTAAGATCTTCCTTAGATTAAGCATCC
ACTCAAAGTCAATACACACTTTCACAACTTTAAGGACCATTTTAATCTCATTCCAAGAAG
TAGACTATTTAAAAGCAAAACCCTTAATACATGGGAGATATATACTTAAATCCAGACTCT
ATTGATGTTGAACTAGATCTCAGTGATGACACAGACAGTGAAACAATTAACCAAAATAAA
CTATAAAAACTTAGCTACTAAATGGAAACTAGAAGCAAAAAAAGAAAAATAAAGCAGGAA
GAGAAGTCTGAAGATCTGTATATAAAAAACATAGTCCAAAATAGCATTAGAAATGAAAAT
GCTTAATAATTTTAATAGCAGCAAATGTTCTCTCAAATGAACAATCAACAATAGTTTCCT
TAACAATAACTCACATAATTCACTTAGAATTCTTTGCTGTAATAATAAACTCAATTTCAG
CAGGATTCGTAAAATAATTTAGGCACTTAAATAAATTCTAACTAAATGTGCTAGATGATG
TCATAAATGATGAGTCAATTCTTTATGACAGGCATGCAACAAGCTCTAAGTTAAAATTTA
CAAAATACTTGCAGTTAATAGCAAAATCCATAATTTTTCCAAAATATGCAGTAATAGTTT
TGCTAGATGATGTCTTAATTTAACAATAATTACTCAACCAAAACCAAAATGAAAGACAGA
AATAATATGAGAAACAAGGATCCTTATTTTACTGATTGGCAATATGAAAAACTATATGAT
TATCAAAGAGAAGGAGTTATGTGGCTTTTTAATAATTTCAAGAAAAAGGCGGGGTGTATA
GTTGCAGATGATATGGGTTTAGGAAAAACAATACAAATTTCTGTATTTCTTGGTACATTG
ATAGACTTACGATTAGTTAAAGATATAATAATTGTATGTCCTCCCACATTAATCGACTAC
TGGATAAGAACTATGAATTACTGGAACTCAGATTTTGAATAAAATGAGTCAGTTATCGAT
GTACGAGAGAAATCAAGCAGATTGAAAAAAATTAGCAGAGCGAAGTAAAGACATCCAGAT
CAGCCTTTAGTTATTGTAATTTCGCCAAAAGTATTTGAAAAAGAATCTGAAGTTTTATGT
GAACTACTTATAGTCGATGTTATGGTTATAGATGAAGGTCATAGAGCAAAGAATATTAAA
ACTAAATTCCGAAAATCCATAAAGGAATTTTAAGTTAAAACAATGAAAATTGTTCTAAGT
GGCACACCAATATAAAATAATCTGTTGGAGCTTTACAGTTTATATGATTTAGTATATGAC
AATATTTTTGGATCTCAAAGCGATTTTAACAGAATTTATGCCAAACCTATCGAAGAAGGG
TGCAAAAAGACAGAAGACGAAAGGGTTATCCGCAGGGCTCTAGAGCAAGCCAAAGAACTC
AAAGATAAATATGAGAAATTCTTTTTGAGAAGAGTTAAGAAGTAAATCTTCCAACTAAGG
TCTGCAGAGTTAAATCCGATTCAAGAAAAGGAACTGGTTTTACCACTTAAAACTGATTTA
GTTGTATGGGTGACCATGTCAAAAATGCAAAACGATATTTATCAATAAATCATTGATCAT
AAACTTACTTAGACAGCTAGAAAACTAACTCGTATTGATCCTACTGAAAAAGCTCTCAGA
AGTAGGAAAGTCTTAGGAATTATAACTGTTTTAAGATGGCTTTGTGTTCATCCTTTTTTG
ACTTTCCATCATTACATGCCAAGTACCCCGAAACCCGGATCTCTTGTGAATACATATTTG
AAAAAAGGGAAAAATAAGGAATATCAGCAGGCTTTATAACAAGAAATTGAAAGAGAAAGA
TAAGAATATTTGAGGTCTATGCAAATTTCCAAAGAGGATCAAAACGAAGTAAACAAAAGT
CTTGACATAGAAAAGCTTTACAAAGCAATAGTGCAATAGTATAACATTAGAAAATATGGG
GACTGGTTCTTTCAATCAAATAAGATACAATTGCTTTTTCTTATGCTTCAGGAGATGTAT
TCTAAAGGGCACAAAGTGTTAATATTCTCTAAGTCAATTAATCTGTTAGATATGATTGAA
CATATTATAATTGAAAGATATCCACATTTTAATCATGAAAGACTAGATGGTAGCGTTGTA
AATTCTGAAAGAGACAAAGTTTGTGAAGATTTCAATAACCCTTAGAATGGTAGTTTTTGC
TTCTTACTATCTTATCCGGATTGGAACCCAGCTACTGATAATTAGTGCATAGATAGACTT
TACAGAATCGGACAACTAAAAGATGTGATTGTATACAGGCTAATTACTGCAGGATCAGTT
GAGGAGCATATGTATCGTAGATAGGTCTACAAAAGTGGTATAAGTCACGCCGTAATAGAG
AAGACTTATGATAAAATTCAAAATTACTTTGACAGCGAAAGTCTGACGAAATTACTCGAT
TATGATCAAAATAAAAAGATCTGTGAAACAATAGATATAATCGAGAAAGAGCACTCATTT
CGAGTGGAGTCAACATAATCAAATCGTGATACAATTAATTTTCTTAGAACTTGCAATTTG
GTGGTTGGCATCACAAACCATTAAGATCTTTATAAAAATAGTGAAAATTGTGGAAGGCCA
ACCAGTTTTAAGGAGGAAGACTGCCTGGAAGAAGACCAAGAGACTTTCTTAAAATAGCAA
TTAGAAAAGATAAGAAATAGTAGCAAGATATGA


>Contig1462.1.g30(protein)
MIDIDIETESDDDQDSILMQSIPQSEKNLQTNIKQEKPNFSVNDLFGCKNENLIGQKMRI
KKVNSVVKKVFDSKIRKFVPIEEFDQNAGSVIKGNKIQKQEKQSTEKIRDQDIDLIIEKT
HESEDETLYVPSSAQNLSPKKLAQEAKDLSIVRSSLDQASTQSQYTLSQLQGPFQSHSKK
QTIQKQNPQYMGDIYLNPDSIDVELDLSDDTDSETINQNKLQKLSYQMETRSKKRKIKQE
EKSEDLYIKNIVQNSIRNENAQQFQQQQMFSQMNNQQQFPQQQLTQFTQNSLLQQQTQFQ
QDSQNNLGTQINSNQMCQMMSQMMSQFFMTGMQQALSQNLQNTCSQQQNPQFFQNMQQQF
CQMMSQFNNNYSTKTKMKDRNNMRNKDPYFTDWQYEKLYDYQREGVMWLFNNFKKKAGCI
VADDMGLGKTIQISVFLGTLIDLRLVKDIIIVCPPTLIDYWIRTMNYWNSDFEQNESVID
VREKSSRLKKISRAKQRHPDQPLVIVISPKVFEKESEVLCELLIVDVMVIDEGHRAKNIK
TKFRKSIKEFQVKTMKIVLSGTPIQNNLLELYSLYDLVYDNIFGSQSDFNRIYAKPIEEG
CKKTEDERVIRRALEQAKELKDKYEKFFLRRVKKQIFQLRSAELNPIQEKELVLPLKTDL
VVWVTMSKMQNDIYQQIIDHKLTQTARKLTRIDPTEKALRSRKVLGIITVLRWLCVHPFL
TFHHYMPSTPKPGSLVNTYLKKGKNKEYQQALQQEIERERQEYLRSMQISKEDQNEVNKS
LDIEKLYKAIVQQYNIRKYGDWFFQSNKIQLLFLMLQEMYSKGHKVLIFSKSINLLDMIE
HIIIERYPHFNHERLDGSVVNSERDKVCEDFNNPQNGSFCFLLSYPDWNPATDNQCIDRL
YRIGQLKDVIVYRLITAGSVEEHMYRRQVYKSGISHAVIEKTYDKIQNYFDSESLTKLLD
YDQNKKICETIDIIEKEHSFRVESTQSNRDTINFLRTCNLVVGITNHQDLYKNSENCGRP
TSFKEEDCLEEDQETFLKQQLEKIRNSSKI