Identifiers and Description

Gene Model Identifier

Contig21260.0.g59

Standard Name

RAD26b

Aliases

Contig21260_0_g59

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR035W3.0000115468388957e-66RAD26 SGDID:S000003796, Chr X
from 497355-500612, Genom...
T. thermophilaTTHERM_002374901.0003503620230312e-57SNF2 family N-terminal domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21260.0.g59(coding)
ATGTAGGATAACTCTAATCAATACGAAGAAAGCAAAAATGAAGAAGAAAATGTCGAGGAC
CCTCGAAACTATTCGCCTTAACATGATACTGACCAGTAGCCATTCTAAAATATAGCACCA
ATAAGCACTAAAGATTGGCTAGCACTCCAATTAAACAATATAAGTCAAGATTCAGAGAAT
TATGAGGGAAAAGATAGGAGAGTTAGCATTGAAAATTATCTCAATTTAGACTCTGATTAA
GAAAATAACAAAGAGAACAAAAATTTTAAGCAAACTCTTTACAATTAAAGAGAACATCAT
AATTCATACCAACCTGAATATAAAAGGCAAAGTGTTGAAAATTTACTTATGAAAATGGGA
CTCTCCGAGTAAAAAGTGAATTAAAAAAGTGATAATATGCGAGATTTCGTAAGAAGGAGC
AGAGATTTACTTGGGTTGAATAGGTAAAGGTTCAAAGATGAAAACTCAGCAAATACAAGC
ATTAATGTCACATTTAATTCTGGAAAAAGAGGAGACTCCTAAAAGAAAAGAAAAGTTGAA
AATTTTGAGGAACTTAAAGATAGCATCATTCAGCCAGATATAATTAAGAAACTTTTTCCT
CATTAAATCATTGGAGTGAAATGGCTTTATGCAAACTATTTAGACAAAATGGGCTGCATT
CTTGGTGATGATATGGGTCTCGGTAAAACTGTTCAAATCTCTGTTTATCTTGGATGTCTC
TTCTAGACTAAGAAGATAAGGTAATGCCTAATTGTCGTTCCTGCTACTCTCCTAGATTAT
TGGAACTCAGAAATTATTAGATGGACTCCAAATATCAACATACAAATTCAAATGTTAAAT
TAAGATTTCAAAAAGAGAGAGACTGCAATTAAAGTCAATAATAGACGCAAGACAGTGTTT
ATTACCTCACCAAATGTGGTTGCCAAACATATCGATACTTTTGGTATGTACTCAAAACTT
GACTTGCTCGTGATAGATGAGGGTCATAAAGCCAAAAATATTAATACTAAGTTTAGAAAA
TCTCTGAAAGATCTCTATGTGAGTAGGCAAAAAGTAATATTGACGGGTACTCCTGTTCAA
AATAATCTCAATGAATTCTATAGCCTGATTGATATTATTAACGATGGAGTACTTGGAGCA
TTTAAAGAATTTCAGTCAACTTACTCTACAGTCATTGAGAGAGGTTTGAAAAAGAATGCT
AAATATTACAATGTTCTTAAAGCATAGGAGATGATATAGCAACTTAAAAATGTCTATAAG
CCTCATTTCTTGAGAAGAACTAAGAAAGAAATTTTCAAGATTAAATCCTCAGAGCTATCT
GAAGTTGAATTGTTACCTAATGAGCTTCCTATTAAGAGTGACTTAGTAATTTGGATTCCA
CTTAATGAAATCCAAAAGAGAATATACAAACTTATACTCGAGGAAGACCAGGTAATGGCA
GCTTAGAAGCATCTTTCTAAAAAGCACATATTCATCATTATTTTGGCTTTGAAATAACTT
TGTGTACATCCTTTGATTCTACTTCACACTTTTTTCAATAATTTTCATGAAGAGATAGAT
GAGGATGAATTAGAAAAGGAAGCTAAGGCAATTGAAAATGATCAGGAGGATATTGAAGAT
ATTTCTGATGATGAAACTAAGCGAAGAATGGTGGAGGAGGTGAAGCATCAAACTCTAGCA
CAAAAACTTGGACTCAGGTACATTAAAAGAATGGTTGAAGATACATATGATTTTAAAGAC
TATGAAAATTGGGTCAAATAGTCAACAAAGATTCAGTTTCTCTTTTAGCTGTTGAAAGAG
CTGCACTAATCTGGTCACAAAGTTTTGATCTTCTCAAAGCTTAAGATTTTGTTAAATATT
GTCTAATAAGTGATCGAGAATGACACTGAGTATAAATTTTTGAGACTTGATGGAGATGTC
CCAATCTCAGCTAGAGATGGCTTATGTAATAAGTTCAACTCAGATCCATCTATATTCTGC
TTTTTGTTGACAAATTAAGTCTCTGGAGTGGGTCTTAATCTGGTATCAGCAGATAGAGCA
GTGATTATTGATCCAGATTGGAACCCAGCTAATGATAACTAGTGCATTGATAGAGTTTAC
AGAATTGGACAGAAGAGAGATGTCATAGTTTATCGATTGATATCAACATGCTCCGTCGAG
GAGAAAATTTATCGTAGACAGGTCTATAAATCAAGTCTTAGCAAAGCCACTTTGGAATCA
AATTCAGAGAAAATGATGAAGTACTTCGATGAACAAGATCTGGTAGAGCTCATGAAATTC
GATGAGAAAGAGAAATAATGCTATACTTTAGATTTGATTTAAGAGAGACACCCCTTTGAA
ATAGTAGAGACCCCAACTAATACCACTCACATGGAGTTTCTGAACAAAAACGAGTATGTC
GCTGGAATTACAAACAATGCTACTTTGTTCTCAAAAGAAGAGGAATTAGAAGAGGAGGAG
GAAGAAGAATACGAGGATATGATTTAAAAGCAGTTCAGTAAGTACTCTAAGTAAAGGCCA
GAACTTTTTGCAAGCAAAAGTAAGAACAGAAACCCATCACTACCAGATGTGTGA


>Contig21260.0.g59(protein)
MQDNSNQYEESKNEEENVEDPRNYSPQHDTDQQPFQNIAPISTKDWLALQLNNISQDSEN
YEGKDRRVSIENYLNLDSDQENNKENKNFKQTLYNQREHHNSYQPEYKRQSVENLLMKMG
LSEQKVNQKSDNMRDFVRRSRDLLGLNRQRFKDENSANTSINVTFNSGKRGDSQKKRKVE
NFEELKDSIIQPDIIKKLFPHQIIGVKWLYANYLDKMGCILGDDMGLGKTVQISVYLGCL
FQTKKIRQCLIVVPATLLDYWNSEIIRWTPNINIQIQMLNQDFKKRETAIKVNNRRKTVF
ITSPNVVAKHIDTFGMYSKLDLLVIDEGHKAKNINTKFRKSLKDLYVSRQKVILTGTPVQ
NNLNEFYSLIDIINDGVLGAFKEFQSTYSTVIERGLKKNAKYYNVLKAQEMIQQLKNVYK
PHFLRRTKKEIFKIKSSELSEVELLPNELPIKSDLVIWIPLNEIQKRIYKLILEEDQVMA
AQKHLSKKHIFIIILALKQLCVHPLILLHTFFNNFHEEIDEDELEKEAKAIENDQEDIED
ISDDETKRRMVEEVKHQTLAQKLGLRYIKRMVEDTYDFKDYENWVKQSTKIQFLFQLLKE
LHQSGHKVLIFSKLKILLNIVQQVIENDTEYKFLRLDGDVPISARDGLCNKFNSDPSIFC
FLLTNQVSGVGLNLVSADRAVIIDPDWNPANDNQCIDRVYRIGQKRDVIVYRLISTCSVE
EKIYRRQVYKSSLSKATLESNSEKMMKYFDEQDLVELMKFDEKEKQCYTLDLIQERHPFE
IVETPTNTTHMEFLNKNEYVAGITNNATLFSKEEELEEEEEEEYEDMIQKQFSKYSKQRP
ELFASKSKNRNPSLPDV