Identifiers and Description

Gene Model Identifier

Contig13957.0.g3

Standard Name

RAD26a

Aliases

Contig13957_0_g3

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00176 ) SNF2 family N-terminal domain
  • ( pfam00271 ) Helicase conserved C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYJR035W9.003614126064233e-119RAD26 SGDID:S000003796, Chr X
from 497355-500612, Genom...
T. thermophilaTTHERM_003882509.996162112727537e-67SNF2 family N-terminal domain
containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13957.0.g3(coding)
ATGGAAATACTAAGCAATTTAAGTGAAAATAAGACGCCAAACATGCTAATTGACCAAGAA
AATAGACTATAAAATCTTTCTGATTAATAAGAATAAGACTAGCTTGATAATCAATCTTTC
TAGGTCAAGGAGATTGAAGGGTTAAACAATAAAGTGATTCAAGAGGAACTTGAAAAATAG
CTAAAGTTAAAGTTGGAAAAAATAGATTATGATATAGAATCGTACTAGAGAAAGCTAGTG
ACAGCAAAAGAAAGCATTAAAGAGTTTGAGAAAAAACCAAACAATAAAAATTTCGCTGCA
GTCAAGAAATTACAGAGTTCTGTTTAGTTTTATTAGAGCTATATCAAGTCCTTACAGAAT
AGGAAAGAAAGGATGTAAAGTGAGTTTGATCAAGCCATAAAAAGTGAGGGCCTACAAAAT
ATGGAATTGCTTGATAACTTTTTCTCAAAGTAATAAGACGCAAAACATTCTGAGAAAAAA
GTCAAAAGGAGTTTACTTGAAATTACAATAGATGGGGACAGATAATTCTACATTTCCGAA
CTTTTCTATAATTTACTGTTCAAGCATCAAGTCGAGGCATTAAACTGGTTGTTAAGTTAG
CATTCTTAAAATAAGGGGTCTATTTTGGCTGACGAAATGGGACTTGGAAAGACAATATAA
ACTATAGCCTTAATAACTGCACTTTTTACCACTTATTATGAGACACTAAACAACAATCTG
ATAGAATAAAGTCAAAATTCCGTAGGTGCCATCCTCATTGTATGCCCTGCTACCGTAATA
AACTAATGGGTGTAAGAATTGAAATTATGGACTACTGGATTGGAGCACTAATTAGAGATT
TTTACTTTTACAAGCGGGAAACATAACGACGAAGAGGTCAAAGCTACAAAGAAAAATAAG
GCTCAAATAATTTAAGAAGCTTTCAAAAAGAATGGGATAGTGATTGCATCTTACGAATTT
CTTAGATCTGAGGTGGTTTTATTTCAACGAAGAACATGGTTTTATGTCATTTTAGATGAA
GCTTAGAAAATTAAAAATAGCTTATCGTAAACTCATTAAGCTGCAATATCTATTTAAGCC
AAACATAGACTAATATTATCAGGTACTCCAATGTAAAATAATTTGTAGGAATTATGGAGT
CTATTTCATTTTGTGTAACCAGGCTTATTAGGTGAGCTTGACTACTTTGAGAATACTTTT
TGTAAAGCTATTATTAAGGGTGGATACACAAACGCAACTAAAGTATAATAGTAGACTGCA
AAAGAATGCGTCGATGAATTAAGAATGATAATTAAAAGACATATTTTGAGAAGGACCAAG
AAATAACTAAAAATGGATTGCAAGCTACCAGATAGAAATGAATACATAGTTTTTTGTAAT
CTAACCTAAGCATAACTCAGTTTATATGAAAAGTATCTAGTTGGATCATAATAACACTTG
GATAAGAGCTTCAATCATAATGAAGCACTAGCAATATTGAATTGTTTGAGAAAGATTTGC
AATCATCCATTCCTATATTTCGCATTTCATGATGCACCAATGAGTACTTCTCATTCTTTC
AGATTTCAGCAGTAGAGACTAATAAACATTCCAGAATACTAGCTATATACAAGAGCAAAA
TAATAACTATAAAAAGATTAAACAAACGATGAAAAATTGCTTGAATGTGAAGCTGCAGCC
AAGTATTGGCAGCTCTCTGGGAAACTAAGAGTGCTCATGAATTTCTTAAAAGACTGGTAT
TCAAAAGATCCAACAACAAAAGTTTTGATTTTCAGTTAAACAAAGAAAATGCTAGATGTA
ATTGAAAAACTATCTTAAAGTAACAACTATTCCTATTTAAGAATGGATGGAAATGTAAAC
TTAAGATCTCGAATGGATATGATTGACTAGTTTAATACACAAGAATGTTTCTTGTTTTTA
TTAACAACAAGAGTTGGAGGGTTAGGTATAAACTTGACAAGTGCAAACAAAGTCATAATC
TTTGATCCAGACTGGAATCCAATGGTTGATGTACAAGCAACAGATAGAGCTCTGAGGATA
GGTTAAAAACGAGATGTAACTATTTATAGATTTATAGTCGATGACACTATCGAAGAGAAG
ATTTATCACAGATAGATTTTTAAGAAATTTATGGCTGATAAAATTCTTCAAGATCCCTCA
AAGCAAAAGCTTTTCGAGAAGTCAACTATGAATGAACTTTTTGAATTGCCTTAAAGAACT
ATTAACGCAAATAAAGAAGAGATGTTAAGAGCATAACTAAAAAAGAGATATCTTGCCCCA
GAGTCTATCATTAATTTAGAGGAAGAAGTTAAAGAGGGATAAGTCTCTTCAAAACGTTTG
AAAAGAAATGATTAAGGAAATGACTCTGTAAATATTGACCAATAATAATTTAGTGATTTC
GAAGAAGGGTAGTTAGATATTGAAGAAGAGTAAGACCATCATTTATCTCGAATGTATAAA
GTAAGCAAGAAAAACATTAACAGAGATGAGAGATTATAAAATTATATAAACAAGACAAAA
AATGAACTTTCAAAAGTTGATGATATTGCTAATAGATTAAAGAAAGATATTTAGAGTGAT
TTGATAACTGAAATTTTTAAGGAGGATAATTTTGAGAACAAAGACGCTAAAAAAGATAGC
TTTAACTATAGCGATTTTTCAACAATTTCTTAACTAAAAATATAGACTGAGGCTAAATGT
GAAGCAGCCAAACTCCTTTCAAAAATAGGGGGAGCCTCTTAAAACTAAAATCAATAAATG
ACATCCTCTTCTATTTTAGGCAATTTATTGAAGAAAAAAGCATAAGAAGAAAATTAAAAT
TAGATAGATACCACAAATTCTAGTGAAAATAAAAAGATTGATTTCTAAAATGAAATTAAG
AATTATTTCTACGACTAGCAAGCTATTGAACTTAGTTCTGATTAGATTCTCAATAATTTT
AAAGAATATGCCGAAGGTGCAGATTACTATTTATTAAAGTAAGCTCTTAAGGACGTTGCC
TTTTTCGATAGAAATGATAAAATGTGGATCCTAAGAGATTGA


>Contig13957.0.g3(protein)
MEILSNLSENKTPNMLIDQENRLQNLSDQQEQDQLDNQSFQVKEIEGLNNKVIQEELEKQ
LKLKLEKIDYDIESYQRKLVTAKESIKEFEKKPNNKNFAAVKKLQSSVQFYQSYIKSLQN
RKERMQSEFDQAIKSEGLQNMELLDNFFSKQQDAKHSEKKVKRSLLEITIDGDRQFYISE
LFYNLLFKHQVEALNWLLSQHSQNKGSILADEMGLGKTIQTIALITALFTTYYETLNNNL
IEQSQNSVGAILIVCPATVINQWVQELKLWTTGLEHQLEIFTFTSGKHNDEEVKATKKNK
AQIIQEAFKKNGIVIASYEFLRSEVVLFQRRTWFYVILDEAQKIKNSLSQTHQAAISIQA
KHRLILSGTPMQNNLQELWSLFHFVQPGLLGELDYFENTFCKAIIKGGYTNATKVQQQTA
KECVDELRMIIKRHILRRTKKQLKMDCKLPDRNEYIVFCNLTQAQLSLYEKYLVGSQQHL
DKSFNHNEALAILNCLRKICNHPFLYFAFHDAPMSTSHSFRFQQQRLINIPEYQLYTRAK
QQLQKDQTNDEKLLECEAAAKYWQLSGKLRVLMNFLKDWYSKDPTTKVLIFSQTKKMLDV
IEKLSQSNNYSYLRMDGNVNLRSRMDMIDQFNTQECFLFLLTTRVGGLGINLTSANKVII
FDPDWNPMVDVQATDRALRIGQKRDVTIYRFIVDDTIEEKIYHRQIFKKFMADKILQDPS
KQKLFEKSTMNELFELPQRTINANKEEMLRAQLKKRYLAPESIINLEEEVKEGQVSSKRL
KRNDQGNDSVNIDQQQFSDFEEGQLDIEEEQDHHLSRMYKVSKKNINRDERLQNYINKTK
NELSKVDDIANRLKKDIQSDLITEIFKEDNFENKDAKKDSFNYSDFSTISQLKIQTEAKC
EAAKLLSKIGGASQNQNQQMTSSSILGNLLKKKAQEENQNQIDTTNSSENKKIDFQNEIK
NYFYDQQAIELSSDQILNNFKEYAEGADYYLLKQALKDVAFFDRNDKMWILRD