Identifiers and Description

Gene Model Identifier

Contig1358.0.g71

Standard Name

RAD24

Aliases

Contig1358_0_g71

Description

Rad17 cell cycle checkpoint protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001911600.0000009995106777214876hypothetical protein
SGDYJR068W0.000050024383570459175RFC2 SGDID:S000003829, Chr X f
rom 567643-568704, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1358.0.g71(coding)
ATGAACTCCCTCAAGAATAGTGCTTTCAATTAGTCAAAGAATAATAAGAGAAAGTTAGAA
GAAATGTCTAACTCAGACTAGTCAACTATTGATACCAATGCCCTTAAATCAAAAGATAAT
ATAGTAGATTCCTCTGACGATCTATGGTCTGTGAAGTATGCTCCAAAATCCCTCGATGAG
TTGATTATACAAAAACCAAAGATTCAAGAATTTGAAAAAATAATGATTTCTGATAATGTG
AAATTGATGATTTTTACAGGACCATCAGGTTGTGGCAAGAACACTTTGATTGATTTGTAT
TGTTAGAAACATAATATTCAGAAATCCGTATTCCAGCTTGAATCAGAATCGAAGAACTAC
AATTTCTTGTAAGACAATGGCATCTATTAAGCTAAAGTTGGTAACCTCGATTACCCAGAA
GACCTTGAGAGTTTGATATATTTCATTAATTCAAGTACTCTCTCTGCGTAAGGTTCAGTC
AGTGGCACAGCTAAAACAGGATTAAAGACAACTTTAAAGTTGTCATCTTTCAATACTAAA
CCAAATCGAATGAGTCATGCTGACACTGAAATGAAGAGCGAAGATGAAATGAGACCTGAT
AATAACTTATAGTAGATTTAGCTGAACAGAAAGATTCTAGTCATCAACAGCGTTCCTTAA
TGCCTATCTCTCTTTAGTGCTAGGCGCAGAGAACTCTTGAAAGACTTTCAAACATGCTTA
TTAAATGTTCTAAATAGATAAACTCCCACACCTTTGATAATTATCACATTCAGTGATCAA
GCTGAAAGATCAAAAGCTTTCCTTCTAAGGATATTCGGGAAAGAAATCCTTAATTTCTAG
GGTAACTCTTAAAGCGCTGCAAACTCTTAGACCTACAGTTAATAGAACAATTCTTCGCCC
TATGTACAACAATTCGCAATCAATTCTCCACATGAGAAGTCTATTGACAAGGTACTAAAG
TAGATTGTTTTTAATGAAAGCATCTATAATGTGGCAGATAGCACATTGACAGAAATTCGT
GATTAATCAAATAAAGATCTTAGAAATGCGATTAATACAATGTAGTTTAAGCTTGCTGGT
AAAAAAGCGGGAGGAACGAATGTTTAGGCTACTGCAGGAAAGAAACTCAAACCTAACACA
AAAAAAAGGAAAAACACCAGTGATGATGAGGAGTTTATGATGAGTGATACTCAGTTACAA
AAAGTCAAGGGATTGAAGAAATAAAACTCCAATCAAGATTTGAATGTTGAAGCGTTTGAA
AAAGATAACAACTTCTCTATCTTTCATGGTCTTGGAAAGTTTTTGTACAACAAGAGAGAA
AATCCTGTGACAGGAAAGAATGAATAGATGTCTCCTAGCAAAATGAAGAGCGAAAATAAA
CCTAAGCTGTACTATGAACACCAAAAAATCATCAACAAGATGTAAATTGAGTCATAGCAA
TTAGGTTTATATTTGCATCAGAATATCCCTGAATTCTTTAATGATATCGGTGATTTAGCT
AACTGTTTTGATATATTTTCTTTGACAGACTACCTTGAAAATTCGATATAGTATAGCTTT
GATAGTTAACTCTAAGTATTAGAGTTCTAATAACACAACGCTTTATTTAGAGCAAAGGCA
ACTACAGAGTGCAATTTCCATGTAGTTAATCCTAAAACTCAGCAACTATTCCCTATGCAA
AAGCCTTAGTACTATGATTTTGTGAAAAACTACAAGGAGAACAAAAGCTAAATGAACTAT
GTAGCAAAGGAAGAGTAAATCCTCAGCCAAAAATTCGTCTCTGAAGATCTGCTTATTCGT
TCAAACAAAGAATGTGTCAAGAATATCTTCCCTTACTTGAAGTAAATGCATCACTAACTT
ATCAAGCCAATAGAAGAGTCAATTTCCTTCTAGGTCAGTGGATTCTACGGAAACAACAAC
TATCAAGGTGGTTATAAAAAACAAAACTTCAAGACTATCTCTCAGCCTCAGGATGAAGAA
AAGGATGATTTCTTTAAGTAGCAAGAGTTTGAAGAGAAGGAGAAGCAGCTTTTCAGACCT
AAATCTAAATTCCACGGCAAGCAATCTGCTATGATTATTGAGCAGAAAAGTCATTTCAAA
GGCTTTAACCCCTAGATCATCAAGCCAAGTTCAATACCTTACCAGTCTAATATTAGCAGT
GGAAGTAAGGAGATTTAGCAAATTGCTTAGTCAGTGGATGATATGCAGATTGACTTCGAC
TAGTTCAATGATGATGAACTTGATGAATTGCTAGGAAACATGTCTTTGGAGGAAGAAATT
TCAGATTCAGACTGA


>Contig1358.0.g71(protein)
MNSLKNSAFNQSKNNKRKLEEMSNSDQSTIDTNALKSKDNIVDSSDDLWSVKYAPKSLDE
LIIQKPKIQEFEKIMISDNVKLMIFTGPSGCGKNTLIDLYCQKHNIQKSVFQLESESKNY
NFLQDNGIYQAKVGNLDYPEDLESLIYFINSSTLSAQGSVSGTAKTGLKTTLKLSSFNTK
PNRMSHADTEMKSEDEMRPDNNLQQIQLNRKILVINSVPQCLSLFSARRRELLKDFQTCL
LNVLNRQTPTPLIIITFSDQAERSKAFLLRIFGKEILNFQGNSQSAANSQTYSQQNNSSP
YVQQFAINSPHEKSIDKVLKQIVFNESIYNVADSTLTEIRDQSNKDLRNAINTMQFKLAG
KKAGGTNVQATAGKKLKPNTKKRKNTSDDEEFMMSDTQLQKVKGLKKQNSNQDLNVEAFE
KDNNFSIFHGLGKFLYNKRENPVTGKNEQMSPSKMKSENKPKLYYEHQKIINKMQIESQQ
LGLYLHQNIPEFFNDIGDLANCFDIFSLTDYLENSIQYSFDSQLQVLEFQQHNALFRAKA
TTECNFHVVNPKTQQLFPMQKPQYYDFVKNYKENKSQMNYVAKEEQILSQKFVSEDLLIR
SNKECVKNIFPYLKQMHHQLIKPIEESISFQVSGFYGNNNYQGGYKKQNFKTISQPQDEE
KDDFFKQQEFEEKEKQLFRPKSKFHGKQSAMIIEQKSHFKGFNPQIIKPSSIPYQSNISS
GSKEIQQIAQSVDDMQIDFDQFNDDELDELLGNMSLEEEISDSD