Identifiers and Description

Gene Model Identifier

Contig21398.0.g83

Standard Name

RAD23

Aliases

Contig21398_0_g83

Description

Ubiquitin family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • proteasome-mediated ubiquitin-dependent protein catabolic process (IEA) | GO:0043161
  • nucleotide-excision repair (IEA) | GO:0006289

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000132909.004005705510192e-49UBA/TS-N domain containing pro
tein
SGDYEL037C4.001033848388204e-30RAD23 SGDID:S000000763, Chr V
from 82603-81407, Genome ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21398.0.g83(coding)
ATGAAAATTATCATCAAGACTCTCCAAGGAAAACAACTCCCTATTGAGGTTGAGGAATCC
GACACTATTCGTCAAGTGAAAGAGAAGATCCAAGCTGAACATCAAATGTAAGCTGATCTA
ATGAAGCTCATTGCCTATGGTAAAGTTATGGAAGACGATAACAAGTCTCTCAAGGATTAC
CAAATCAAGGAAGGTGATTTCCTCGTAGTCATGATCTCAAAGGCAAAGCCAGCCCCAAAG
AAGCAGGAAGATGTTAAGATGGAGGATGTACCAGATGCTCAATAACAGCCAGCTGCTCAA
TAGTAACAACAACCAGCAGCAGCTCAACAGCAACCAGCTGCTTAGCAACAACCAGGAGCT
GGAGCTGCTGATGCTGGCGGACTAAGCCCAGAGCAAGAAGTTTAGGTGAATGAGTTGGTT
ATGATTTCAGGCAAGCCAAGAGATCAGTGTATTTTAGCTTTAAGAGCAGCTTTCAATAAT
CCAGATCGTGCTTTCGAGTATCTTTTGTCTGGTGTTAATCTCCAGGCTCTCGCTAGTCAA
CCAGGTGGCTAAGAAGGAGCTGGTGCAGGTGGTGACGATATGGGCGATGACTATGGTGAT
GAAGAGGGATCAAGCGATCCATTTGGAGGTGCAGGTAATCCATTTGCAGCACTTGCTCAG
AACCCCAACTTTGCCTTGATCAGATAAAGAATCCTACAAGACCCTCAATTCTATCAACAA
TTCATGTCACAACTCCAACAGACTCAACCACAATTGTTTGCACTCATTCAACAAAACCCA
GCAGCATTCATGAACTTGATTCTTGCTGGTGATCCAAACGCCGGCCTTGCTGGCATGGCA
GGTGCTGGAGCTGGAGCAGGACATGCTCATGGTGGTGCTGGAGGTGCCAACCCACCAGGC
TCAATTAGAGTGACTCAGGATGAGATGGAAGCTATCAACCGTTTGACTTCCCTAGGATTC
CCCAAGCACAAAGCAGCTGAAGCTTACTTTGCTTGCGACAAGAATGAAGAACTAGCAGCT
AACTATTTGTTCGAAACTGGTTTCGAAGATGAAGAAGCAGCTCTATAAGAGTCAATTGTT
GCGTCATCCCAACAACCAGGTGCAGGTGGCCAACCAGCTGCTTAGTAATAACAACAACAG
CCACCACAACAACCACCCAGTGACAACAGTGGAAACTAACCAGGTGGTGGATCTGATCAA
AACAAGCCTGATGATGATGATTCTAGTTTGTTATGA


>Contig21398.0.g83(protein)
MKIIIKTLQGKQLPIEVEESDTIRQVKEKIQAEHQMQADLMKLIAYGKVMEDDNKSLKDY
QIKEGDFLVVMISKAKPAPKKQEDVKMEDVPDAQQQPAAQQQQQPAAAQQQPAAQQQPGA
GAADAGGLSPEQEVQVNELVMISGKPRDQCILALRAAFNNPDRAFEYLLSGVNLQALASQ
PGGQEGAGAGGDDMGDDYGDEEGSSDPFGGAGNPFAALAQNPNFALIRQRILQDPQFYQQ
FMSQLQQTQPQLFALIQQNPAAFMNLILAGDPNAGLAGMAGAGAGAGHAHGGAGGANPPG
SIRVTQDEMEAINRLTSLGFPKHKAAEAYFACDKNEELAANYLFETGFEDEEAALQESIV
ASSQQPGAGGQPAAQQQQQQPPQQPPSDNSGNQPGGGSDQNKPDDDDSSLL