Identifiers and Description

Gene Model Identifier

Contig12596.0.g13

Standard Name

RAD2

Aliases

Contig12596_0_g13

Description

XPG I-region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006703904.000904604388404e-59XPG N-terminal domain containi
ng protein
SGDYGR258C7.002264059090237e-38RAD2 SGDID:S000003490, Chr VII
from 1010766-1007671, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12596.0.g13(coding)
ATGGGTGTAAAAGGCTTATGGAATCATTTATTGCCAGCTGCAAGAAAGATAAACTTAGAA
GACTTGGAGGGTCAAGTCTTAGCGATTGACGTATCCATTTGGATAATCTAATTCATAAAC
ATAATTCAAAGAAAGAATGATTACAATGTTATAGATGGATTTCTCAGAAGAATATGCAAA
TTGCTCTTCTTTGGGATCAAACCTGTCTTTGTGTTTGATGGATCCACCCCTTAGATTAAG
AAGAAGTGCTTAATGATGAGGAGGAATATTCGCTAAAGATAGTAGGTTAACTATAACAAA
GCAGCTGAGAAATTACTGCATAACATAGTCAAGGAGACTCTCTTAAACTAGATTTAGAAT
TAAAACAAACTCAAAAGCATAGAGAATAATAAGTCAGAGTAGTAGGAAGCTCGACAAAAT
AATCAAGAAGAAATATCGTCTTTTGACGATGAGGGAATAATGAGAAATCTCCAACAAATA
TCAGACAAAATTCAAAATTAGGATTATGAACAAATAGACACGCAGTTTCATCCAGTTAAA
AAATAAGATTAATCAGACGAAGAGGATAGTCAAGAAGTAACTCAGATGTAGAAATTTATC
CTTGAAAAGTATAAGTCTCTACTCAGAGAGAATGAGATAGACGAGGACATTTTCGTGCAT
CTTGATATTGACGAGTAATATGAAATTATCGAGGAACTTGAAAGAATCAAGAAAGACTCA
GCCAGAGAAAGGTTTGCAGAGATTCAAGATGACCTTCAACAATTCTCTGAAGTATAAATA
TCTAACTTTATCAATCAAATCAAGGAAAAGAAGAGGTAGAAGGAGATATTAATCAAAGCC
TCTGAGGCTGAACTAAATGCCATGAATTAAGAACAAAGATAAGCTTATGAAACTTAAAAT
CAGTAGAATGGAGTTTAAAACATGCGATTTATATTTAGAGACAATTATGGAAAATAATAG
CCAAACTTTTAGGCCTCAAGCTATCTACCAACAAAGATCGTTTAAGTTCTTGAGAAAGCA
AAGTTGAAAAGAACTAGAAGAGGAAAAGGTAAAAATGACATTGAGAAACTACTCTAAGAT
TCTGAAAATCAGGCAAACTCAGATTATATTAGTCAATAAGAAGTCTATGGAGTCTCTCCG
ATCGAATATATTCGTGGATAGATGACTAAAATACAGAAGAAATTGGACATAGATGAACTT
AGTGATATAGAAGAGAAGGAAAATCTTAAGTTTAAAGAGGAAGAAGTTTAGTAATTTGCG
ATAGAAAAAGAGAAGTAACTCGATAGTATATTAGAAGACATGTTTGGGGAAGGGGATGAT
AGTGAAGAGAAATTTATGTTTAACTAAAATGAGAAGCAAGAGTAAAATGAATTTTAATTT
GGGAACTTTAATGAGGAAAATGAAGAACTAAGCAATTTCATATTAAAAGAGCAATATTAA
TAATAACTTTCGAATGATTTTAATGACTAAATAAGAGTTACAGATGATGAAAATTTAAGC
TAGAAAAAACAAAGAGATTTAATTGAGTTTGAGAGTTAATTCACTGAACAAGATAAAATT
GATAAAGAACATTCGAATGGCTAGTCTTTTTCTCATCTATAGAGTAGAGACATGAAAAAT
TTCTACATAGAACAATCCACTAGATAGGGTGGTATTGGAATAAACTCAGAGGTATAGAAT
ACCTAATAGAAAACTGAAGAGAAGCCAGCTTCAATTGTTTAATATGCTTACAATAGATTG
ATTGATGTAAATAAGAATCTTAGTCATTTTAGAGAATCTGAAAGCTCACCAAGTAGTTTA
CAAAATTAAGTCTAAGATTAATAAATGAGGGATGACTCATCATTTCTTATCAGGGATTAA
AAACTTGTGAAAGAATTGCAATAAAAATAATCAACAAATAAGAAAAGAAAAGCAGAAGAT
GATGAGGATACTTATCTTTAGAAGACTCTTTTGATTGAATAAGAGTTAGAGGAAGAAAAA
TAAAAGTAATTGAATGATATAGATGCATAGATTGATTAGAAATTTGAATAAGTTCAGCTA
GCTACTTTTGATAACTACGAGAATATTAACTTTGAGGATTTTGATAACATTACGACTTTG
GATTAATCTCAAGTTTAATCCTTAAATCGTCCTCAAAATCGTTTCGCAGTGAACCCAAAC
GATATTGAAAAAATGAAGTAGGATATCCTGGAAGAGAATATTTACTTGATAAGTGAACTG
GAGAAAACAGCAAAACACTTTACATACTTCAGTTAAGAGAACACTCAAGAGCTAAAGACT
CTACTCAGACTATGTGGAATTCCATTTGTTTAAGCTCCTTTTGAAGCTGAGTCTCAATGT
GCTTTCCTTGAAATAAATGGATTAGTAGATGGAGTGGTAACAGAGGACTCTGATGTGCTT
TTGTTTGGAGCAAGGAAAGTATACAGAAACATATTTGATAGAAACAAATTTGCTGAAAAA
TACGACATGAAAATTATTGAAAGGGAGATGGGACTTGATAGGGATGATCTTATAAAAATG
GCCTTATTCATGGGTTCAGATTATACGATGGGAGTACGAGGAATCGCCGCTGTTAATGCA
ATTGAAATTATTAATTCCTTTTAAGGAGATGAAGGACTAGAGAAGTTCAAATAGTGGGTT
GATATTAAGCAGCAAATCTAAGATTAAGCTTAAAAAGATTCAGATGAAGCTGGAATTGTT
AAAAAATCTTAAAAATAGAAATTGATAGAAGCTCTTGAAAACGCACTTACCGACGAAGAT
AAAGAAAGGCCAGAAACAGAGATAGAAAAAGAGTATAAAGAAAAGCATAAAAACTGGAGA
AGACATTGGGAATTCCCACAAGATTTCCCAAGTAACGAAGTAATCAAGGCTTATAAAGAT
CCTTCAATTGATGACTCTAAAGAAAAATTCACCTGGGGTACTCCTGCATTCTAGGAGTTG
AAATCTTTTGCAATTATGAAACTTGGCTGGGAGGGCAGAGATTTAGATTAATATTTCAAC
ATAGTAGAGAAAAGAATGAAAGAAAGGGAAGGTATAGATAAGAAAAGGGGCACTCTAGAA
TAATACTTCAAGAAAGAGGAGAAATTTGCAACAATATAAAGTAAAAGAGTTGTACAGGCT
GTTAAAGATTTGTAACATAGAAAGAAGAGACTTAAAAAGAATTAATGA


>Contig12596.0.g13(protein)
MGVKGLWNHLLPAARKINLEDLEGQVLAIDVSIWIIQFINIIQRKNDYNVIDGFLRRICK
LLFFGIKPVFVFDGSTPQIKKKCLMMRRNIRQRQQVNYNKAAEKLLHNIVKETLLNQIQN
QNKLKSIENNKSEQQEARQNNQEEISSFDDEGIMRNLQQISDKIQNQDYEQIDTQFHPVK
KQDQSDEEDSQEVTQMQKFILEKYKSLLRENEIDEDIFVHLDIDEQYEIIEELERIKKDS
ARERFAEIQDDLQQFSEVQISNFINQIKEKKRQKEILIKASEAELNAMNQEQRQAYETQN
QQNGVQNMRFIFRDNYGKQQPNFQASSYLPTKIVQVLEKAKLKRTRRGKGKNDIEKLLQD
SENQANSDYISQQEVYGVSPIEYIRGQMTKIQKKLDIDELSDIEEKENLKFKEEEVQQFA
IEKEKQLDSILEDMFGEGDDSEEKFMFNQNEKQEQNEFQFGNFNEENEELSNFILKEQYQ
QQLSNDFNDQIRVTDDENLSQKKQRDLIEFESQFTEQDKIDKEHSNGQSFSHLQSRDMKN
FYIEQSTRQGGIGINSEVQNTQQKTEEKPASIVQYAYNRLIDVNKNLSHFRESESSPSSL
QNQVQDQQMRDDSSFLIRDQKLVKELQQKQSTNKKRKAEDDEDTYLQKTLLIEQELEEEK
QKQLNDIDAQIDQKFEQVQLATFDNYENINFEDFDNITTLDQSQVQSLNRPQNRFAVNPN
DIEKMKQDILEENIYLISELEKTAKHFTYFSQENTQELKTLLRLCGIPFVQAPFEAESQC
AFLEINGLVDGVVTEDSDVLLFGARKVYRNIFDRNKFAEKYDMKIIEREMGLDRDDLIKM
ALFMGSDYTMGVRGIAAVNAIEIINSFQGDEGLEKFKQWVDIKQQIQDQAQKDSDEAGIV
KKSQKQKLIEALENALTDEDKERPETEIEKEYKEKHKNWRRHWEFPQDFPSNEVIKAYKD
PSIDDSKEKFTWGTPAFQELKSFAIMKLGWEGRDLDQYFNIVEKRMKEREGIDKKRGTLE
QYFKKEEKFATIQSKRVVQAVKDLQHRKKRLKKNQ