Identifiers and Description

Gene Model Identifier

Contig29.1.g109

Standard Name

RAD18b

Aliases

Contig29_1_g109

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13923 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam13639 ) Ring finger domain
  • ( pfam13920 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam00097 ) Zinc finger, C3HC4 type (RING finger)
  • ( pfam11717 ) RNA binding activity-knot of a chromodomain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007806607.003307964816097e-28hypothetical protein
SGDYOL054W0.0000007997233352734267PSH1 SGDID:S000005415, Chr XV
from 228614-229834, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig29.1.g109(coding)
ATGACATCCAGCATCAAGCACCTCACTAAAGAGAAATTATGTAAAATTTACTTTAGTTTT
TTTTACACTTTATAGAAGAGAAAATTCAAATCATAGTTTGATTTTGAATTAACAAACCTC
GCCGCAGAGATAAAACCCTGCAAATATCGCCAATTTGAGCGTAAATCAATAAAGAATCAA
ATATCAAACTTGAATGAGATAAACAATCCCAGTGGTTTAAACTAAGCAATTGGGAATTTC
GATGATGAAATTGATGATGAATAAATGCAACAAATACTCTATATGGATGACTGTAATAAT
AGAAGAAAGAGACAAAAAGTAACTTTTTAAGATAAACAGGGGTAGGGGAATAAGAAGTAA
CAAAACTGTAAGAATAGCTCAAATTCCATGAATGGGATGATTAGAGAAAGCAATGACTTA
AATTAAAAACAGAAATCTTCAAATTAAAGTTTGACTAATTAAAATGAAATGATTCGTGAA
AACTTATATGGCAATGAGAGCTAGTCGACTTTAAGCCAAAGTAAAAATTAGCAAGATTAA
CAACCCCATTCACAAAACTCTGATTAAGAATTAACTTTTTCTAAGAAAGTGAGATTCTCA
GATTAACTTGAAGTTCAAAGCCAAGATAGGCTCTCTTTGAATTCTGAGAGTAGTAGCAAT
TCTGGCAAAAAGAGAGAAATAAAATCTGTTATGAAGCAAGAGTAAAAGAGTCAGAGGAAC
TAAGTTAGCTTTTAGGAGCCCTCTCAGCTAAATGAAAAAGAAATGATTCAACCCAGGAAT
ACTTTGAGAGAGAGTCAATAATCTAATGCTCAAAATTAGATATAGGAAGTTTCAGTTCAA
ATTGATACTTCAACCAACAAAAATTAAGTATAGTAACAACAGTAGGAAGAAGAAGTTCAG
CTTGAGCTTGAAACCTAAAATTTAATCAAAGAATTGGAACAAAAATTGAGTCACTACTAG
AAAGCTATGTTTGACAACACCAAAGCAATAGAGGAAGTTCAATGCTCAATCTGCATAGAC
ATGATAATAGGTTGTAGAGTTGCAATTTGTGGCCATACGTTTTGCAATTAATGCCTTACT
GAATGCTTGATAAGAAAGAAAATTTGCCCTTAATGCAGAAAGGACATCAGGAAGTCTCCA
ATTTAGAGAAATAAAATGATAGATTCGCTCATTAAAAGTGTCATCCAATCTCGTTATTAT
GCTTCAGACTGCAAAGATTAAGAGGGAGAATATTAAAGATACGTCGATAGAGTGAAATCT
TACAAAGATTGGAAGCTTAAGCACAAGTTACAGGGGAAGTAAATCAAGGCAGGGGATAAG
ATCGATGTGAGAGACACCGAATATGTGTGGTGTGTAGGCATCATTCAATATAAAATATCG
GTGACTAGTTCTAAATTCCCTCTTCTCTACATTCATTACGATGGTTGGAACAAGAAGTAC
GATGAATATTTGTATTCAAATTCGTAGAGAGTAGCCCCACTTTAAACTTACACAAGTAGA
CCTGACATCCCAAGATACTATATGGTGCCCAGGAACAATATGATGTATGCCAGAATTATT
GAGAATCAAGCTGAACTTGCTCAACTTCAAGCAGCTGAATAGTAGAATCAGGACTTAGAG
TCTGAAGAGGACATCGAAGAATAAGAATTTGAAGAAGATGAAGAAGCTCAAGCTGCAGAT
GCTTAAGTTTAAGAACAAGAATAATAATAATAAGTAGAGTAGTAAATACCACATGTCCCG
ATCTAAAATTAAAATTAGCAATTGAATAATTAATAAGAATAATTCAGCAATAATTCTATA
AGTTAATAACAAAACGTGCTTTCCTAAGTTGACGATTTACTTAATAGAAACCCAAACATT
TTAGAAGATGCAGATGTAGTAAGTGTACCCCCATAACCCCCCAATAGTCAACCAATTATT
AATGAACTTATGCAGGATTTCATACCACCTAATAATCGGTAAGAATCTCACGTGTAAAAC
AATGAATTAGTCAATTCCAGCGTTTAAAATCAACCAGAATCTTAATAATCGTAATAGCAA
GCCAATCTAATTAACCAAATTGATTCAGTGAGAGAATAATCTAATTAGGTAAATCATCTC
AGGGGAGAGGTAGCTAGGATGACATAGTAAGTCAGAGACCAAATGAGTCAACTTAATAGA
ATTCAAAGTGAAAGAGAAAGTTTAAGTCAAAGACTGAGAGTATTAAATAGTCCTATCCAC
GGATCGACTGGTTTACAAGAACTCAGGGCTGAATCAAGAAACAGGCCCTTCAATGTGTAC
TTCTCAGAAAACAGACAGAATGATCCTCTATATAGATCTACATAGAGAATGTAATAAAGA
GACAATAGGTTTAATAGTCTGTAAAATAATGATAGAAATTTCAGTAGCGATAATTAACAT
GATTAAGTGAGAAGAAATACAAATAGAAATGCTTATCAGAATGCACAGTCTTCGCTAACC
AGTACCAGAACTTAACAGTTACTTGGTAATAGGCAATTATCCAGGTCTGAAATTATGAGA
AATAACATTACTTAAAATCGTGCAGTTCCTAGTCAATCACAAAACCTTCCAGGTCTAGCA
ATTACTTCTCAATAAGGCTTAAACATTTCAACAGCTTCAACATTAAACACCACTAGTTAA
TCTCAACTGTAAGCTATAAGCAATCCAAGATAGTAGCTACAACCATTGACTAATACCTCT
TCTGTAATGCGTTAAATTGAAGCTGGTATTGATAGAATTTAGAACATAGTGGATCACATA
AGAACCAGGTCAGACTCTAGATACCCCTCTCAAAGTCAGCAGCCACTAAATACAGCTTAA
TTGGATATATCTCAACAATCAATTTAATCAAGTAGTTCAACACCAGCTAATAATTCCTAA
AATACTATATAGAATTCATCATCGAATAGAGCAAGAAGTGATGGGGCTAATGCTTAAAAT
AGCAATTAGTCAAACTAGTAAGAGTGA


>Contig29.1.g109(protein)
MTSSIKHLTKEKLCKIYFSFFYTLQKRKFKSQFDFELTNLAAEIKPCKYRQFERKSIKNQ
ISNLNEINNPSGLNQAIGNFDDEIDDEQMQQILYMDDCNNRRKRQKVTFQDKQGQGNKKQ
QNCKNSSNSMNGMIRESNDLNQKQKSSNQSLTNQNEMIRENLYGNESQSTLSQSKNQQDQ
QPHSQNSDQELTFSKKVRFSDQLEVQSQDRLSLNSESSSNSGKKREIKSVMKQEQKSQRN
QVSFQEPSQLNEKEMIQPRNTLRESQQSNAQNQIQEVSVQIDTSTNKNQVQQQQQEEEVQ
LELETQNLIKELEQKLSHYQKAMFDNTKAIEEVQCSICIDMIIGCRVAICGHTFCNQCLT
ECLIRKKICPQCRKDIRKSPIQRNKMIDSLIKSVIQSRYYASDCKDQEGEYQRYVDRVKS
YKDWKLKHKLQGKQIKAGDKIDVRDTEYVWCVGIIQYKISVTSSKFPLLYIHYDGWNKKY
DEYLYSNSQRVAPLQTYTSRPDIPRYYMVPRNNMMYARIIENQAELAQLQAAEQQNQDLE
SEEDIEEQEFEEDEEAQAADAQVQEQEQQQQVEQQIPHVPIQNQNQQLNNQQEQFSNNSI
SQQQNVLSQVDDLLNRNPNILEDADVVSVPPQPPNSQPIINELMQDFIPPNNRQESHVQN
NELVNSSVQNQPESQQSQQQANLINQIDSVREQSNQVNHLRGEVARMTQQVRDQMSQLNR
IQSERESLSQRLRVLNSPIHGSTGLQELRAESRNRPFNVYFSENRQNDPLYRSTQRMQQR
DNRFNSLQNNDRNFSSDNQHDQVRRNTNRNAYQNAQSSLTSTRTQQLLGNRQLSRSEIMR
NNITQNRAVPSQSQNLPGLAITSQQGLNISTASTLNTTSQSQLQAISNPRQQLQPLTNTS
SVMRQIEAGIDRIQNIVDHIRTRSDSRYPSQSQQPLNTAQLDISQQSIQSSSSTPANNSQ
NTIQNSSSNRARSDGANAQNSNQSNQQE