Identifiers and Description

Gene Model Identifier

Contig7313.0.g36

Standard Name

RAD18a

Aliases

Contig7313_0_g36

Description

Zinc finger, C3HC4 type (RING finger)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007806609.99967697349061e-30hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7313.0.g36(coding)
ATGATCAAAATACTCAATAAGAAGGCTTAGATGCAAATCAATAACTCGAAACTGAATATG
CAGAAGGAAATTATCAAGCTTTCACTTTTTGGTAAAAGACCAAGAACTCAAAGTCAAGAA
TCAGTAAATAATAATATCCAAGAAATTCAGGGTTAAGATAACCAAAATTAGGATGAAGAT
GATAGTCTAAGTTTCTTTTCAGATAATTAAGAGGATCAAGAAATGAAAAATGTCGTGGAA
GAGGTTGCTTAAAATTAATAGTAGAAGTCTAGTTTTATGGAAGAAGATGATGTAGCAGCA
ATTGGTAATTAATAGATTGGAAGTTTACAGACTGAGGGTTTAAGTGGCTTGCAGAAATTG
CTATGCCCGTTATGCTTGAATTGTATCTATAAGTGTACGACTACTGTCTGTGGTCATTCA
TACTGTGAGAAGTGCTTGGAAGAATACTTAATCATTAGAAATTACTGCTACATCTGTGAG
GAAATAATCAGAAATAAGCCATTGATGTCTTGTTTTTCAGTGGACAACATTATCGATTAA
CTAATTCACAAGAGTGAAGATCAGGATATTAAAACATAGTGGAGCAGTTAAATTAAAGTT
CATAAGGACTGGCAAGAAAAGAAGAAGTTGAAATAAGTTGAGGCAGGTCAAAAGATCGAT
GTGAGAGACACATCATACATATGGTGTGTCGGCTTTGTAAGGATGAAAATTGAACATCCA
ACATAAGAACCACTTATAGTGATTCACTATGAAAACTGGAACAACTACTACGATGAGATT
ATCAAAGCCAACTCACCGAGATTAGCTCCTTTAGGATTTTATACTGAAAGAAAGGACATA
CCCAAATATTAAATGGTCTAAGGGTAGAGACAGATGGTAGCCAATATCATCAATAGAGTG
CCCAAGCAGCCAAGAGAATAGTAAAATGAACCTAAACAGACTGTCGAAATCTAAGCATCA
GTTCCCCAAAATAGTGGACAGCCCTAAAACCCTTCTCAAAATTAACCTTAAATTTAACCA
GCAGCCTCAAACGCAAACCCAGATGTTTTAAGAAGAAGAGAGTCAAATGCCAACATAGGT
GATCACCTCTACGATAGATTAAATGACTTCTTCAGAAGATGCTAAGAAAATACAACTATG
AACTAGAAAGAAGGCCCTTTCTAAAATGATTTCCTCTACGCCAGGCATGTAATGGATTTG
CTGTTGAACTAGACCACTCAAAGTTAGAATTAACTCGAAAACTCGAATGTCTTAGATTTA
TTGTTCTCTGGTTAGAGTTTTGCACAGATTAATGCCTAGATTTAACGATATGCCAATCAA
ATATAGCAAGATCCTCTTCCCTAACCTGCTGCAAACTAACAAGCTTAACAATAGCCTGTG
CAGCAAAATCCTCAGAGGAACTAACATTTGGTAAATTAACTAAACTTAGTGAGATAAGAG
ATAAATCAGCATCATGATAACTCTCTTTCTAATATCGTTGATAGACTTCATTAGCATGTG
TTGAGAAGAAACAACTACATCAATGACAATTAAGCTAGAATTCAATAACAATCACAAAGA
TAACAGCATTAATAGTAATCGAGGGAGCAACAATAGCAGTAATAGCAGTCAAATCCATAA
AATTAGCGTCAACAACGAGAAGTATAACAAAGAGCTTAACCAAATGCTGACCTAGCTCCT
GTTGTCTAAAATCAATAACAACCCAACCTCAGAAATATCGTTGAATCTGTGTAATAGAAC
ATCTAGTAAGAATTATAAGAATTCGTTGGGAATCTATTAGGAAGTGCACCTAATTCAAGC
AATTTAGCGGAAGCCAACTATAACAATAGACGCAATGAGCGAGTTTAAATGAGAAGAAAC
GATCCAAACTAGCAAGACCTAAGCTCCATTTCTTCCCAAGATATCTTTTTCGACTTTGTA
TAGCCACTAAACAATAATAATAATAACATCTAACACCAGAATGTCTCTTCAGTGATTGAA
CCTGCTTAATAATAGCAGCACAATTAACTATTGGAAGTCTAATAGTAGCAAGAAAATGAG
ATTAATTATTTGATGGAGGAAGTGCAAGAAAATTAAGCTAGAAATTTAGAAGTTATAGAT
TCCATTAGCTTGTAATAATCATCATAAGTGTAACAGGATTAATAGGCTAATTCTATAGCT
AATGGAAGGCAGGAATCTAACAATTAAGCTGAAGCTGATGACATCAACTGA


>Contig7313.0.g36(protein)
MIKILNKKAQMQINNSKLNMQKEIIKLSLFGKRPRTQSQESVNNNIQEIQGQDNQNQDED
DSLSFFSDNQEDQEMKNVVEEVAQNQQQKSSFMEEDDVAAIGNQQIGSLQTEGLSGLQKL
LCPLCLNCIYKCTTTVCGHSYCEKCLEEYLIIRNYCYICEEIIRNKPLMSCFSVDNIIDQ
LIHKSEDQDIKTQWSSQIKVHKDWQEKKKLKQVEAGQKIDVRDTSYIWCVGFVRMKIEHP
TQEPLIVIHYENWNNYYDEIIKANSPRLAPLGFYTERKDIPKYQMVQGQRQMVANIINRV
PKQPREQQNEPKQTVEIQASVPQNSGQPQNPSQNQPQIQPAASNANPDVLRRRESNANIG
DHLYDRLNDFFRRCQENTTMNQKEGPFQNDFLYARHVMDLLLNQTTQSQNQLENSNVLDL
LFSGQSFAQINAQIQRYANQIQQDPLPQPAANQQAQQQPVQQNPQRNQHLVNQLNLVRQE
INQHHDNSLSNIVDRLHQHVLRRNNYINDNQARIQQQSQRQQHQQQSREQQQQQQQSNPQ
NQRQQREVQQRAQPNADLAPVVQNQQQPNLRNIVESVQQNIQQELQEFVGNLLGSAPNSS
NLAEANYNNRRNERVQMRRNDPNQQDLSSISSQDIFFDFVQPLNNNNNNIQHQNVSSVIE
PAQQQQHNQLLEVQQQQENEINYLMEEVQENQARNLEVIDSISLQQSSQVQQDQQANSIA
NGRQESNNQAEADDIN