Identifiers and Description

Gene Model Identifier

Contig1119.1.g104

Standard Name

RAD10

Aliases

Contig1119_1_g104

Description

Binding domain of DNA repair protein Ercc1 (rad10/Swi10)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03834 ) Binding domain of DNA repair protein Ercc1 (rad10/Swi10)
  • ( pfam12826 ) Helix-hairpin-helix motif
  • ( pfam10372 ) Bacterial membrane-spanning protein N-terminus

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYML095C0.0000000010002658722841845RAD10 SGDID:S000004560, Chr XI
II from 82113-81481, Geno...
T. thermophilaTTHERM_000116500.0000899730839127287Mating-type switching protein
swi10, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1119.1.g104(coding)
ATGAACTAAAAATCTGTTGGCAACAACAATCCAATGTAGCCAAATAAAATTGAGTAGATG
TATGCAAATACTTCCAATTCAAGACCCTTAAACAATAATCAGTCTAATAACTATGGAAAT
GGGAGTACCAATAATCGTGGGCGAGGTGGAGCAAACAATAGAGGAGGGTATGGAAACACT
AATTAGCAAGGGCTTTTCAACCGAAATCAGGTTAAAGTCAACAAAAAATAGGAAACTAAC
CCACTTTTGAAGTACTCCCGTTTCTAGTATATTCTTGTAGACGACTAGAACCCCCAGCAC
TAAACGTCTCCAATGTTTGAAGATTACGACATCAACGAGAAAGTATCTCTCTTGTTTCTC
TAACTCTCCTACCACATAGCCTACCCTCTCTACATCATTCAAAGATTAGAGGACATCTAC
AGGCACCGTAAAACCAGAAACAAAATGCTTTTGGTTTTAAATGATGATAAAGATGACTAG
AACATGATTAACGGACTGCTTATGGAGTGCATTAAGTTTGAAACTAAGATGATTATGTGC
TGGAGCTTTGAGGAGGCTGCGTAGTATATTTAAACTTTCAAAAGCTACGAGAATAAAACT
CAAACTATGCTAGAGGGAAAGTACTAGAATCAAGGGAACACTCATCTAGAACAAGCGACA
GATGTCTTGGGATCAATTCGCAGAGTGAATAAAACCGATGCGAAGAATCTTTTGTGCAAT
TTCGGCTCAATCGAGTAAGTGATTCTAGCACCTAGCTATGAAGAGTTCTTGAACATGGAC
GGAATTGGACAGAGCAAAATCGATGCGATCACACAGTGTTTCAGAGGCAAGTTCGTAAAC
TATAAAGGATAACCAGTTGGTTCAGGTGGGCAAGTATCGAATTAGATTAGTGCTGCTAGT
GACGTCTCTAAGAAGCTTTTGTTGTAAGAGGGAGAAGATCAGGTTAAGAGTGATAGTAAG
CTACAGAAAGAATAAGATTTAGAAGAAAGTAAAGAATAAATTAAAGAGAAAGAGTGA


>Contig1119.1.g104(protein)
MNQKSVGNNNPMQPNKIEQMYANTSNSRPLNNNQSNNYGNGSTNNRGRGGANNRGGYGNT
NQQGLFNRNQVKVNKKQETNPLLKYSRFQYILVDDQNPQHQTSPMFEDYDINEKVSLLFL
QLSYHIAYPLYIIQRLEDIYRHRKTRNKMLLVLNDDKDDQNMINGLLMECIKFETKMIMC
WSFEEAAQYIQTFKSYENKTQTMLEGKYQNQGNTHLEQATDVLGSIRRVNKTDAKNLLCN
FGSIEQVILAPSYEEFLNMDGIGQSKIDAITQCFRGKFVNYKGQPVGSGGQVSNQISAAS
DVSKKLLLQEGEDQVKSDSKLQKEQDLEESKEQIKEKE