Identifiers and Description

Gene Model Identifier

Contig1225.1.g107

Standard Name

RACK1

Aliases

Contig1225_1_g107

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011131001.99970314379378e-94hypothetical protein
SGDYMR116C2.9997879492220375e-71ASC1 SGDID:S000004722, Chr XII
I from 499878-499456,5006...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1225.1.g107(coding)
ATGGACAGCAGTAGTGTTAAACATCAGCTTGAATACAAGGGTTTCCTGAAAGGTCACAAC
GGTTGGGTTACATGCATGAAAGTCGGTGAAGTCACCGAAGGAGACCAAACCAAAGAGTTC
CTCATTTCAGGTTCAAGAGATAAGAGCATCATGATCTGGGATATCGTCCAAAAGAAGGAT
CAAGCTGACTCCGACAAAGAATGGGGTGTACCAAAGAAGGTCTTGAAGGGACATGGTCAC
TTCGTCAGTGATTTGACTCTTTCACAAGACAGCAGATATTGCTTGACTGGTTCATGGGAC
GGTACCCTCAGACTATGGGATCTCAGAAAGGGATGCACCATTAAGAGATTCGTTGGTCAC
TCAAGAGACGTTCTTGCTGTTGCTTTCTCCCCAGACAACAGACAAATCGCCAGTGGTGGT
ATTGACAGAAACCTTAAGATCTGGAACACCGTTGGAGAGTGCAAATTCACCGTTGAGCAA
AACGCTCACACCGACTGGGTCTCCTGCGTTAGATTCTACCAAGATGTTAAGACCCCAATC
GTTGTCTCAGCTTCATTTGATAAGACCATCAAGGTTTGGGACAACCAAACTATGACCCTC
AAGCACACCTTCGTCGGCCACAAATCTCAAATTAACTCATTGGACATGGCCCCCAACGCC
TCTTACTTGGCCTCAGGTGGTAAAGACGGTCTTGCTATGATCTGGAACCTCGTTGAAGGT
AAATTCCTCGGACAAAAGGAAGTTGACTGCGCCATCAACTGCGTCCTCTTCGCCCCAAAG
AACTACTGGCTCGTTCTCGGTACCGATCACGGTATCAAGGTCTGGGACCTCCCAACCAAG
GAGTTCATCGTTGACTTCAAGGCTGTTCCAATTGATGCTAACAGAGAAAAGCAAACTGCC
CCAGTTGCCTGCACCAGTTTGGCATGGAACAAGAGCGGAAACATCCTTTTCGCCGGTTTC
AACGACAGCTACATTAGAGTCTACGAAATCGCTGCTGAGAAAAGCGCTTGA


>Contig1225.1.g107(protein)
MDSSSVKHQLEYKGFLKGHNGWVTCMKVGEVTEGDQTKEFLISGSRDKSIMIWDIVQKKD
QADSDKEWGVPKKVLKGHGHFVSDLTLSQDSRYCLTGSWDGTLRLWDLRKGCTIKRFVGH
SRDVLAVAFSPDNRQIASGGIDRNLKIWNTVGECKFTVEQNAHTDWVSCVRFYQDVKTPI
VVSASFDKTIKVWDNQTMTLKHTFVGHKSQINSLDMAPNASYLASGGKDGLAMIWNLVEG
KFLGQKEVDCAINCVLFAPKNYWLVLGTDHGIKVWDLPTKEFIVDFKAVPIDANREKQTA
PVACTSLAWNKSGNILFAGFNDSYIRVYEIAAEKSA