Identifiers and Description

Gene Model Identifier

Contig18208.0.g33

Standard Name

R3D1b

Aliases

Contig18208_0_g33

Description

Ribonuclease III domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18208.0.g33(coding)
ATGAGCATATAGAACAAAAGGGATTTGTAATAAGAAGTTACGTTTTAATCTTGTCCAAGC
TATAAATAGTAACAACTTATCTTAATTGCCAACACCAGTACTGAATACAAAAACAAAGAT
TATTAGGAACAAAATGGTTAACATAATGACGATAATTTCATATAAGGGCTTGGTAAATAC
GAAGTCAGCGAAGTAGTGAACCAATTGGACTTAAACTTCTGTGGAGAGTCAAATGACTTT
ATAGTTTACTAATCAAATCCAAAGACAAGACCTATCATCAAAGTCCCTCAATAAGAAGAA
TATATCAGAACAATGATTTATGATGGGAAATAATAAGCGAAACTTCATATGAGACACGCA
ATTACATATTTAAGAGACTACCTGGAAAAAGAAGAGCTAAAAATTATGAGGATGCAAGGC
TTGCTAAATGAAGACAGACTCAAAGAAATTGCACTCAAAAATAAGAACATCATTAAGTGT
TTTGATCCAACCAAATTCTAATCACTTGCAGAATTTGGCCCTATATATGAGGAGAAAATA
CAAAATAGGTTTAAAAGGTATAAATCTAAATGTAATTTCTTACAGAACAACTTTGGACTA
ATCTTAAACAAAGAATTTAAATCTCATGAATTCTTCAATACTAAAGAGGAATCAAGTTGG
TGGAGCAAGAAAGTAGACGCTGATATATACGCAGCATTCGAAACTGTAAAACTACTGCAG
TATCTGAAACTTATAGATAATCATTTTTTGATAGACTTTCGACTAAAACAACAAAGCAAT
TATGAAGATAAAAATCCCTAGAGCATCTAGTAAATTTTGTTGTCAAATAAAATGAAAAAC
TAAAACTCTAAAATAAAATAATTAAATGAAGAAATATATTAACAAAATTAGTTGCAATCA
AAAATATTTGGAGTTTAAGAAGATTGCGGAAAATTTATTAGTACAATTGAAAATTAAAGC
ATGATGTACAATAAAATATTCACTAACTCTTATCTAAAGTGTCTATCTCTAAACCCTATA
AATTCAAGCATAGATAGCCTTCCACGATATAAAATGGGACTACTCTTTAACATAGAAGAA
GATGTTTAGCCATAGAGCGTAAATAATAACAAAATTGAAGGTTTATCAAGCGATGATTAG
ATTATATGTAACTTCATTAAGAATAAGAAGGAGTCTCAAATAACTGAAATTTACTTCGAT
GGCAACAGAAAACTGGCTGAGTTAATTGTTTGTTTTCACCTATACTCCGTTTTTTTAATG
AATAGCTCGTTACATGAACTATACTATAGAATCCTCACTAGATAGTATGATAGTCTCTTC
TTTAACATCCAAAACAGTAAACCCGATCAAAACTAAGAGGATTAGAAACATCATTTATTT
AGTGATTTGATTCAAATATTAGAGAGAGATTAAGTTTGTAAGAAATTCTTTGATGGTGTT
TTCTCTCATAAAACTGAATAAAATATACAAGCCAAAAATGTAGTTAATTTTACTGTAAAC
CAGTCTCATGACAGAGTTTATAACCTTATTGTGCCACTAAAGTTGGTTCCAAATACTGAT
TAATACATTATTGATGAGATAATTCTTCAAAAAACATTCGAAACAATGCGTAGAGACATC
ATTTAAAACTATCTTGGCTTGAAAATTCACAAAGAATCATCAAATTAATCTATCGATAAA
GGTTGCGTATATCAGAACCCCTTTACGCTCGGATCAGTACAAATATAGAGTTCAAGCTTG
CAGCAAAATCAGTGCAACCTTACTACTAAGGTGATCCTTTTACCAAGTTAAGAGATCATC
GCTCAATCATCTGCCGCAAGTTCAGATAATCCATAACTTTTAAGCAAATAGCTTAAGTAC
CACAATTAAGTAACATTTCTGAAAAGCACGCAAGAATTCTATCTAATCACACAAGGTGTA
TTTCTGAAAAGAAACAGTTAATAAAGACTTACAAAGTCTAAGAAAATTAAAAGTTTGACA
GATTCCATTAATTCTGATACAGTGCAACAAATTTTTAATAAAGACAGTTTAGTATTAAAA
AAAGAAAATAGTTAATTAGGACCTTCAATCGTGAAGCAAAGAAAAATTAAACCTTAGGAC
TTCTTAGAAGTAAAGGAAGAAAGTATATTAGACAATGAAATGGATTTAAAACACAGTCAA
GAACTTGTGCTACTCGATATTTCTTCAGAGCATTTGATATAGCTGCCATTTAAAATTCAA
TAATATATGGAGCTTTAACGGGTAAATCAGTTGTACTCAATTTTAACATAAGGTTTAAGA
GAGAAGAACTTTTACAAAGAATTCATTATAGGAGAAATGCTAAATGCAAATATATAAGAA
AAAGTATAGTCAGAAGAAAGAAAAAATGAGCCAATAAATCTGGATGATGAAATTTTTAAT
TCTGATGAGGAATCTCATAATTATAAGGCATAAATCAATCCAGAGCAGTCGATAAAAAGC
CAAAAATTAAATGACATTTAATCTCAAAAATATCTTGAGGACATGCTCTAACTAAACTTT
GAAGAGGCTCTTTCTTCATCCCAAGTCGATAAAAATTAGAATTACGAGAGATTAGAATTC
TTGGGAGATAGTGTACTCAATTTTCTTTCACTCTTAGAGTTATGTACAAATTTCTCTAAT
CTCAAGAATAAAGAAATTGACATATTAAAGGTAGACACAGTATGTAACAAAAGACTAGCA
AAAGCAGCCGAAACAAAGAACCTACAGAGATACCTAATCGAATTAAATTCCAATAAACAT
GGTCAATCCCAAGGCGGCTCTAATTCGCATTAAGTAATACCTGGGCTATTTGAAAGATAG
GACTATGAGCTTAACATTTCTAGCAAAACTTTACAACAAACTGAAAGTAAAGTTGTGTTT
TTAAATCAATTGAGATAAAAAATCCTCAGTTAACTTGAATATCAAAAGCTTCATAATCTA
TCAGATCCAATTATGACTGACGACTATGAAACAATCGTGAATTGTATAATCGAAAGAAAA
TCTCTATAATAAGCTCTTGTTCATTATATTGAACAGAATTATCCATAAGAAGCCAGATAC
TCTTTAAATTTTGAGAAAGATTACCCAAATTAATACTATTTGAATAAAATGCTTAAAAAC
TTAAAACTTTCACAGCTTGACCTAGAGCTAATAATCATTGACTCACAAATTGATAAACTT
TAATTCAAGCTCAAATCATCACTCTCTAAGAGGAGTAATGAATCAAGTATAAGATCAAAT
CAGTCAAGTTCATAGATAGTCAGGTAATCAAAGTAGGCATCCCACTCTGCTTCATAAAAT
CCAAAGTAAATAAAACTCATGGCTGATGTGGTTGAAGCCTTGACAGGACTTTTTAGTCTT
TAAAACCTTGAATATTCCTCAATGTTTCTAAAACAACTCGGAATCATGAGTAAGACTTTA
AAAGAACTACAAGAAATAGAGTAAAAACCTTTGGAAATTATAGATATTGAAGGAGACATG
TAAATATAAAAATTAACATCAAAAGTTACATCTACATTTAACGTACTGGAGCAACAAATT
CTCAAAGGCACTAATTTTGAATTCAAAGATCGAAGAAGGGCTTTTAAATGTATTATGCAT
AAAAGTTACATAGAAAGTGAAGAAGCAATAAATGAGTTTGGCAAAAGAGGTGGAAACTAG
GCATCACATTAACAAATTGATGAAATAATAGCTAACAACGAAAGATTCGAATTCATAGGA
GACTCTATTCTCAATTACGCTGTAACAGATTATGTCTTTCATAAAACCAAGAATCAAGTT
AAAGATAACAGTCCAAAATATTTGCATTTAATGAGATAAAACGTTGTTAACAATATCATG
TTGACTCATATTGTTGTTTAATTGGGAATAGATAAACTTATACTTTTTGATACCAAAGCA
TTTTCCTAACCTCAAAACTCTAAAAAATAATGGTCAATTGCAAACAGTCTAAAAATAATT
AGAGAAGCAGTATAACAATCTCCAATGTCAGAGAACATTCAAGCATACAATAAATTACAA
ATCAGATAACAATAAATTAATGCATTATAAGATGGAAAAGAAAAAAAAGATCTGGCAAAG
ATATTGGAATAAGATTTCAAAGACTTTAGATACTCTCTTTAATACATTCACGATGTAATA
CATGAACATAACAATAAAATGTTCAGTGATGTGTTTGAAGCAATTATTGGTGCAATATAT
ATGGACTGCAGAGATTTCAACAAAACGAAGGATGTAGTGCTTTATCTTATGAAAGATTAC
TTGGCCATATTCACAGATATGGGTATCATCCTCGACAACCCAAGAACAGCAGCTATTGAA
CTTTGGGATTAACAAACATACTCAAGAGGCTTAAAACTACAGCACATAACCACAGTAGGA
AATAATCACACTATGTTTATAGGAACTATTGGAGACATGCAAGCACTGCGAATCAGGTTC
CAAAACACTAAAAAGAATAAAATCAGAGAATTCTACAAAAATTTCTTCTTATTCTTGTAA
AGCTTCGTTAAAGTATGCAAAGATGAAAACATCATTGACAAAGATTTAATGTTAAAAAGA
TTGGAGCAATTCAGAATAGACTTTAAAATCTCAGAAAATGTGTGA


>Contig18208.0.g33(protein)
MSIQNKRDLQQEVTFQSCPSYKQQQLILIANTSTEYKNKDYQEQNGQHNDDNFIQGLGKY
EVSEVVNQLDLNFCGESNDFIVYQSNPKTRPIIKVPQQEEYIRTMIYDGKQQAKLHMRHA
ITYLRDYLEKEELKIMRMQGLLNEDRLKEIALKNKNIIKCFDPTKFQSLAEFGPIYEEKI
QNRFKRYKSKCNFLQNNFGLILNKEFKSHEFFNTKEESSWWSKKVDADIYAAFETVKLLQ
YLKLIDNHFLIDFRLKQQSNYEDKNPQSIQQILLSNKMKNQNSKIKQLNEEIYQQNQLQS
KIFGVQEDCGKFISTIENQSMMYNKIFTNSYLKCLSLNPINSSIDSLPRYKMGLLFNIEE
DVQPQSVNNNKIEGLSSDDQIICNFIKNKKESQITEIYFDGNRKLAELIVCFHLYSVFLM
NSSLHELYYRILTRQYDSLFFNIQNSKPDQNQEDQKHHLFSDLIQILERDQVCKKFFDGV
FSHKTEQNIQAKNVVNFTVNQSHDRVYNLIVPLKLVPNTDQYIIDEIILQKTFETMRRDI
IQNYLGLKIHKESSNQSIDKGCVYQNPFTLGSVQIQSSSLQQNQCNLTTKVILLPSQEII
AQSSAASSDNPQLLSKQLKYHNQVTFLKSTQEFYLITQGVFLKRNSQQRLTKSKKIKSLT
DSINSDTVQQIFNKDSLVLKKENSQLGPSIVKQRKIKPQDFLEVKEESILDNEMDLKHSQ
ELVLLDISSEHLIQLPFKIQQYMELQRVNQLYSILTQGLREKNFYKEFIIGEMLNANIQE
KVQSEERKNEPINLDDEIFNSDEESHNYKAQINPEQSIKSQKLNDIQSQKYLEDMLQLNF
EEALSSSQVDKNQNYERLEFLGDSVLNFLSLLELCTNFSNLKNKEIDILKVDTVCNKRLA
KAAETKNLQRYLIELNSNKHGQSQGGSNSHQVIPGLFERQDYELNISSKTLQQTESKVVF
LNQLRQKILSQLEYQKLHNLSDPIMTDDYETIVNCIIERKSLQQALVHYIEQNYPQEARY
SLNFEKDYPNQYYLNKMLKNLKLSQLDLELIIIDSQIDKLQFKLKSSLSKRSNESSIRSN
QSSSQIVRQSKQASHSASQNPKQIKLMADVVEALTGLFSLQNLEYSSMFLKQLGIMSKTL
KELQEIEQKPLEIIDIEGDMQIQKLTSKVTSTFNVLEQQILKGTNFEFKDRRRAFKCIMH
KSYIESEEAINEFGKRGGNQASHQQIDEIIANNERFEFIGDSILNYAVTDYVFHKTKNQV
KDNSPKYLHLMRQNVVNNIMLTHIVVQLGIDKLILFDTKAFSQPQNSKKQWSIANSLKII
REAVQQSPMSENIQAYNKLQIRQQQINALQDGKEKKDLAKILEQDFKDFRYSLQYIHDVI
HEHNNKMFSDVFEAIIGAIYMDCRDFNKTKDVVLYLMKDYLAIFTDMGIILDNPRTAAIE
LWDQQTYSRGLKLQHITTVGNNHTMFIGTIGDMQALRIRFQNTKKNKIREFYKNFFLFLQ
SFVKVCKDENIIDKDLMLKRLEQFRIDFKISENV