Identifiers and Description

Gene Model Identifier

Contig17740.0.g110

Standard Name

R3D1a

Aliases

Contig17740_0_g110

Description

Ribonuclease III domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003161890.000000000000005001692698841201conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17740.0.g110(coding)
ATGACTAGTAAATCCTAAATACGTTCTGAGATTAATAATGATTCAAACAATTAATCAAAT
GATCTCAGAAGTGATTCTAATCAACTATAGGATTCTTAATATGGGACTACCAACATATCT
GATGAATCCGAAATTATCAAAGATCTATAAGTCAGCGATTTCATTGACAAAACAAAGTTC
GGCTACTAGGACACAATTGTACAAAGGATTATAGATTAATGGAAATAAGATGAATTAGGT
TCTATAGTTTTTATTGACACTGGTACTGGTAAATCATACATTGCTTTGAAGCTAATCAAA
CACATTTTTAACTTGGACAGCAGCGTCCTGAATCCTTTGTCAGAAGAATAAAAACAAAAA
AAGATTGATATGAGTGATTAGCAACTTAGAGAAGCAGAGAGAGAGCAATCGAAAATTGGC
TTTGAGCAGCAATAAGCCCTGAATTAGGCATAAATGTAAAAGAAAAGCCCCAAAGTGTTT
TTTATTGTTCCTACACAGCATTTGGTAGAGTAACAAAGTAATGTTATCAATGTCTTCACT
GAAAATCTAATCGTGAGATAAATTAAAGGAGGGACCAGTTAAAAGATCTATGATCCTGCT
GTCTGGCCTGCATTCTTTAAACACACCGACATTTTCGTAATCATAGCAAAGAAATTCATT
GACTTGATAAAACATGGCTTATTATCATTCGACGATATAGACCTACTAATCTTTGACGAA
GCTCATCATACATAGCAAGATCACCCGTACAACCTTATAATGAGCGACTATTTCTACTTC
AATTTAATTAAAAAACATCAATAATAACATCAGAGAGCTTTAAATTTCATTGCTAATCCA
GAAAAAAATCAGATAGAGTAGATATAGAATAAATTTCATGTCACAAGAATTTTGGGTTTA
ACAGCTTCTCCAATTAAGAGCAAGTAGCCCACTTTGGCATTCAAACATGAATTAAAATAA
ATATTACAGGAACTTTCAAACAATCTTTTCTCTAGATTCGTGGCAATATCATAAGAAGAA
TCTCTAGAAATGAAAAATCATTCTGAAGTAATTCTGACTACATATAAATTTGACTTTGAG
GATTGTTCTGGTAAAATTACATATCTAGAAAAGAAATTTATCATACCCTTGATTGAAAGT
GTGAATCTTTCAAAAAGTATCTACATAAAAGCCGATCATGTATCCATGTCATAAACCTTG
CTTGAACTACTAAATGAAAATTTACTAACTCTATCCAAAATAGACAATGACTAACAACTC
ATTAAATTTCAAACATCAAGACTAAAACTGTTGGATATAAAAGTTGATGAGACTAAGAAA
TGTATCGATTTGTCGAATTATTAAACTGAGGATGAAAAAAAAACAGTTATTTTAGTAATC
ATTCTACTTAAGAATTTGAATAACATGGTTTTGGAATTAGGTTCAAACGGAGTGATGCTT
TTTATCGTAGATTTAGAAAAAGACTTAATTGAAGGCAATTAAAAATGGTCACCATCTCAA
AAACAAGCTTTAAAGGACCTTTTTAATTAATTCAAACATGATATTAAAAAAAATATAAAT
TTACTCAATGAATCGTCGATGTCTAATAAAATATAGAATTAACCCATAGCTGAATTAATC
AAACCTTAATTCATTGACGAAGAAAATTAATTAGATACTGCTATCATATTGAACGAGGAA
GAAAATCAAGAAATTATTAATCAAATTTAAGAAGAAAGCAAATAAAAAGTGGAAGACATT
CCAGAGTAAAATGACTAAAATAACTAAGAATAAATTAAGTAATAGAAATAGGCCATGAGT
AGCTTCAATCTAGATAATCCTTAGTTTGACTACAATTTACAAAATATATCGCCCAAAGCT
TAAAAATTAATAGAAACACTTGACAAAGAGTATGAATAGAGGAAAAGCAAAGGACAAGAA
CTGAAGGCAATTATCTTTGTTAAAGATAGAATTATTGCAGAGTACTTGAAGAGAATACTC
TCATAATATTACGAGTCCCAATAAAACCTTGCGTAACAAAAGGAAGATAATTAATCACAG
TTAAACACTGAAGAAAGTTCAAGCAACTAATCAAATATACTTGACATGTTAAACGAATAC
TAGCATTAATATGATAAATTCAGGTTTGGACTAGCTATCGGATAGAAAGGCAGAGGTCTA
ATCAATAAAGCTGTAAATTCCACGAATAAATAAAAGATATTAAACCAAATTGATGAAATG
GAAGTGTTTGAAAATTTATTAGGAGACTTTAATTTCTCTAAAGTTAAAATGACTAGTCAG
CAATTGACAGAGACAATATAAAGTTTCAAGTCAGATAAACTTAATGTACTAATTGCAACC
AACGTCATAGAGGAAGGATTAGATATACCCAATTGCAATTTAACAAAAGGAAGAGCTCGT
TAAAAGAATTCGAAGTTTATATTTATGTGCTCGTAAGAACAACGAGCGCAGCAAGAGCAG
GAGATTTAAGGTTTTAAGGAAACCATAGAGAAAATTTAAGAGTTAGCATACTGTGAAGAC
GAGGAAATTGTTCCAACTAAGGATGTTCTCTCACTAAAAGTAGTGAAAGAAAACAAATTT
TTTAGAACTTAAAAGAATGCTATGATAATGAGTAGAGACTGTCCCTCAATGATTGAAGCC
TTCATGAAAAGTTATACAGAAGACTTCAACAAAGGCAGAATAAATCCATTGGAGGTTAAA
TCGATCAATGTTTCAAACCCAAAGGAAAAAGCTTACTCAAAAGACCTGGACCCATTAAGG
TTGAAAGAAAAGACAAAAATCGTTACGAAAGAATAAATTACAGAAAATACTAAGTTTTTC
AGGAGTGTTCTGATTTTTCCAGAAATTATTAAAAATTTGATTGATAATGTTAAAGGGACC
AGGTGGTTTCATAAGAAAAAAGAATCCTAAAATCACACCTACATGTTAGCTGTTGAAAGA
TTGCACAAAGCCTAATTGATAGACGACCATTTATTCCCTGTCATTAGAAGACTTTACTCC
CAATCCTTTTTAGAGAGGCTTTCATTACAAAGTCAACCAGTCAAGCAAGTTCCAAAGGCA
AACCCTAATTAGAATTAGAATACATCTGCTAAGAAGCAAAAACAATAACAATAATAGGCA
TAAATGAATATATCGTCATATTCTTACTAATCTTCAATGACTGCAAAATCAGCACAAAAA
TCTTAAAATCAATCTCAACAACAAATTATTCACTAGCAAAACATAATAAAAAAGGAGAAA
AATCTACAAGAAAGAGAATAGCTAAATGAGGAGCAGAAAAGATTCTAAATGGAGACCAAC
ACACTTTCATAATAAATGATGCCAAAACTTCATGATTTCGGTATCTAAGGTACCTAAGAT
TTAGTAGCCAAATTAACAGGGAAGAAGCTCTATTGTATCATCATAGAGCCAGTGAATTAA
GAATCTAACTACCCATTTTTAAATACAAAAAACTATATTGGAATTATATAAGACGAGGAC
ATGAATGACTTCGATTGTCAATACGTGCTCTAACAAGAAAATAAGTAAATTCTTAAGAAC
GGACATTATCTTTACAACCTTGAGCAAAAGAACTTGATAAATTATGTGGATAGAGTCTTA
TAAACTTAATATGAAGATGAACTAAGCTTCACTAAAAAAGCAATCTTGTTAGACACATCA
AATATGCCATATGAAACTTTTAGAGATTTCTCAGAGCACCTAAAATTATTTCACACTTTT
ATCTTTTTCTTTCTGTATAATGGGTAATACGAGTTCTACAAGAGAGTCATTACTAATAAA
TTTAAGTTTTCAAGACAATTTAGAAACTTAATTTCACTTATTGCGAAAGATAAGAGAAAA
ACTATGGCTGGATATTATTTTACTTAACAGGTCCTGGGGATAAGTAGAAAATAGTTGGAA
GATGTGCTTACTTAAATAGATAGAAATTAGTATGTTAATGAAGAAAACGGTAGATTATGT
GATAATATGCCTGACTTACAAACAAATATAATTCCAATTAAAATTGATAAAAATGGAAAA
AGAGAAATAGATTTCAAACTAATTTAAGATACCTATGACTATATCAACACAGAAATACTG
AAATTAGTATTCTAAAATTACTAGGTAAAAGATTTGCAAGATAAATTTGGACTTATTGAT
CAGAGAGACCATTTATACTTCAGAAATGAAATTGAATCACCTAATAAAAACCACCATATG
AAGTATATTCAAGTCTGCGAATCTAACTAGAATCTTTATTAAATTATGGAATCAAATAAA
GTCAATGAAGAACTATGGCAATCTAAAGAGATCAAATTACTCCCTAGTTAGGTTAAGAAA
ATCTTCCCTAACGTCAATGAAAGTATTTTAATGCATTAATATGGTGAGTTTTTGAGTGTA
TAGGAGCATTATTTCGCAAAGACTGGAATATACCTTCACAAAAAAGAGAATTAAATCTTC
TTCAAGTGCAGCAAGTAGAGACACTTTTTGGATTTTTCATAATAAAAAATCTAATTATTA
TAAGAATCTTAACCTGGATAATAAAAGATTGAGCAACCAGTCTAAGAAATTCAAAAAAGT
CACGAAAAAGTAATGCCCTAAAACTTACAGAATTTAACCAAAGAAATAAATGATTACTTT
TAATAAAATTATTATTACAACTTAGATGATAACTCAAATTATGATGATCCATATGAGGAG
TCTAAAGTTAGTTAAAATCACTATAACAATAACACGTAGATCTTAAACGAAACTTTTTAC
GGAGGAATTTAAATAATAAAAGACATTGATTATTTCTTCACATAAGCACACCGTAGTTCA
AATGATAATATTGACCTATTTAGTTTGAAGTAAAATTATATCAATTTACATCAGGATTGC
ATAAACTACTAAGAAATGTCTGATGATAAATTCACTGAAGCTTCACAATATTTCTTGAAG
AATCCTCTCCCAGCGATTGAAGCGCTCTCTTCGCCCACTGCTAATCAGCTGTTTCTTTGT
CATGATAAAAACTGGGATGAAGGGAAACTGGATCTTAATAGAATAAAAAGAGTCTCCAAC
ATGAGGTTCATAAAAGTAAATCAAGATGTAAAACTCTATGAGTACATGATTTCAGAATAA
TCCAAGATATACAATGTTTATGTGCCAATTGGCTTTGAAAACAAGGACTATCAATAAAAT
GTAAAATAAAAGCATATCAATGAAATACAAACTAAAATTTTACATCTAAAAAAACAAGCA
TTTATGTTGGAATTAGAAATGAAAGAAAATTTCTAGCAATCCACTCAGGACTACGTAACA
GATGAATATATAGAGACAATTAAACTTTTTATTTCTTAAAATGACTTGAAAAATTACCTA
AGAACTTTCAAAGATGGTCTAGCATTGCATATACTAATTCAAGAAATCTATAATGATAGA
AGCAATGAGGTGATGTAGTATCAGTAAAAGAACAAAAAAGAAATTGAAGTTAATGACTTT
ACTCACAGCCTCCTTTATCGAGTAGGAACTCGTTGGATTAATGAACTATCCCTAAAACTG
CCTCAATTAAAGAAAATAGTCGTCACAGAAAATCTGGCTAAATGTGAGAATAAGCTCTAA
GTAGAAATGCTAAAAAGGAAAAATCTTGAAAACTCAAATAGAGAGAAGAAGCAATTTTAA
TCTAAGTAGCTAGCTGATGTAGTGGAGTCAGTAACCGGAGCCTTAGCTTCTAAATGTGGA
TTATTTACTGCCAGAGAATTCCTAATGAAAAAATACAACTTATTGGAATTCTCTGTAGAG
TAATACAATGAAAAGCTCAACGAGCTGTAATTGTCTTCAACATCAATTTACAAAGTTGAA
CAATTCAAGGAAAAAATTGATAAAGTTGAGAGTATCCTTGGCTACACATTCAAATACAAG
GAAATCCTTCTCTAAGCTCTAACTCACAAATCAACAAAAGAATCATTATAAAATTAGGCA
AATTAAGAAAATTACAATGACTATGAAAGATTAGAATTTCTGGGTGATTCTATTTTAAAT
TTCCTAGTAGCTCAGCATTTCTTTTTGACAACTTAAGATAAGCCAGATGACTTCAAGCCA
AAGCAATTGCACAAATCTAAGACTTCCATCGTCAACAATGTGATTCTAAGTTTAATCGTA
ATTGAGAAAGGTATTTATGAAAGTATCATCTACAATCAACTGTCTGAGCAATTCAAGACG
TAATTTGAAGCGTATGTTCAAACTGTCAAGAAAAAAGTAGCAATAGTCCCAACTAAAATC
CTTGCTGAAATGAAAGAAGCAAATATCGATAATGACGAATAGGCTGAGATGTTCATTAGT
TAAGGTAACAACAAAAACGTGGTGGATAATGTATACAAAAAGTTTATAGAGTAGGCAGAC
AAAAAGCTGAATCCTTCGAAATACAGATTAAACGAAGATGACCTTGATGATCTCTCATCT
GACGAAGAACTGAAAGAGGATGGGGAAGTGGATATCAATAACCTACCTATCACATTGACT
TAAAAATGCAAATTCCTTAAAGACTATGTTATTGACTTAGACGATCTCTACAAGTTTTCT
CTGAAGATTTTCGGTGACATATTTGAGAGTATTATTGGTGCAGTTTTTATCGATTCAAAA
TGTTTGCAGACCACATCAGATGTGCTGTTCAGACTTCTATAGCCATATATGGTAGTATAT
GCTGACATCAAATCTGCTTAAGATCACAAGAGAACCACTTTGCTTGAATTATGGAACTCT
AAGAACTATGCAAAAAGAATAAAAATCTCGCACATAAATACTAAAACTGCCAACGAGGTC
TAATTCAAAGGAAAGGCTGGATCGATGGTGGTATTCAAAATGACCTTTAAAAAGGATGAA
AAAAATAAAATCAGGACTTTCTACAAAGAATTTTTGGAATTTATAACAAGCTTTATTAAG
GCTTTTGAAAGCCAAAACAGCAAAGAGCATCAAACTGAAGAAGCCATGATATCTCATATA
GATTAATACAGCAAAAAATGGCATGCAAAGGCTTAATAGTAAAAAAGAGATGAACTGATT
AAATAAAAAAGAGAAAATGAGAGACTTGCAGGAAATTAATATGCAGAAAGTAAGATCTAT
CAATAAAATAACTCTTCAAACGTCATTATTAATTAGAATTGCATCTAGATTCAATGA


>Contig17740.0.g110(protein)
MTSKSQIRSEINNDSNNQSNDLRSDSNQLQDSQYGTTNISDESEIIKDLQVSDFIDKTKF
GYQDTIVQRIIDQWKQDELGSIVFIDTGTGKSYIALKLIKHIFNLDSSVLNPLSEEQKQK
KIDMSDQQLREAEREQSKIGFEQQQALNQAQMQKKSPKVFFIVPTQHLVEQQSNVINVFT
ENLIVRQIKGGTSQKIYDPAVWPAFFKHTDIFVIIAKKFIDLIKHGLLSFDDIDLLIFDE
AHHTQQDHPYNLIMSDYFYFNLIKKHQQQHQRALNFIANPEKNQIEQIQNKFHVTRILGL
TASPIKSKQPTLAFKHELKQILQELSNNLFSRFVAISQEESLEMKNHSEVILTTYKFDFE
DCSGKITYLEKKFIIPLIESVNLSKSIYIKADHVSMSQTLLELLNENLLTLSKIDNDQQL
IKFQTSRLKLLDIKVDETKKCIDLSNYQTEDEKKTVILVIILLKNLNNMVLELGSNGVML
FIVDLEKDLIEGNQKWSPSQKQALKDLFNQFKHDIKKNINLLNESSMSNKIQNQPIAELI
KPQFIDEENQLDTAIILNEEENQEIINQIQEESKQKVEDIPEQNDQNNQEQIKQQKQAMS
SFNLDNPQFDYNLQNISPKAQKLIETLDKEYEQRKSKGQELKAIIFVKDRIIAEYLKRIL
SQYYESQQNLAQQKEDNQSQLNTEESSSNQSNILDMLNEYQHQYDKFRFGLAIGQKGRGL
INKAVNSTNKQKILNQIDEMEVFENLLGDFNFSKVKMTSQQLTETIQSFKSDKLNVLIAT
NVIEEGLDIPNCNLTKGRARQKNSKFIFMCSQEQRAQQEQEIQGFKETIEKIQELAYCED
EEIVPTKDVLSLKVVKENKFFRTQKNAMIMSRDCPSMIEAFMKSYTEDFNKGRINPLEVK
SINVSNPKEKAYSKDLDPLRLKEKTKIVTKEQITENTKFFRSVLIFPEIIKNLIDNVKGT
RWFHKKKESQNHTYMLAVERLHKAQLIDDHLFPVIRRLYSQSFLERLSLQSQPVKQVPKA
NPNQNQNTSAKKQKQQQQQAQMNISSYSYQSSMTAKSAQKSQNQSQQQIIHQQNIIKKEK
NLQEREQLNEEQKRFQMETNTLSQQMMPKLHDFGIQGTQDLVAKLTGKKLYCIIIEPVNQ
ESNYPFLNTKNYIGIIQDEDMNDFDCQYVLQQENKQILKNGHYLYNLEQKNLINYVDRVL
QTQYEDELSFTKKAILLDTSNMPYETFRDFSEHLKLFHTFIFFFLYNGQYEFYKRVITNK
FKFSRQFRNLISLIAKDKRKTMAGYYFTQQVLGISRKQLEDVLTQIDRNQYVNEENGRLC
DNMPDLQTNIIPIKIDKNGKREIDFKLIQDTYDYINTEILKLVFQNYQVKDLQDKFGLID
QRDHLYFRNEIESPNKNHHMKYIQVCESNQNLYQIMESNKVNEELWQSKEIKLLPSQVKK
IFPNVNESILMHQYGEFLSVQEHYFAKTGIYLHKKENQIFFKCSKQRHFLDFSQQKIQLL
QESQPGQQKIEQPVQEIQKSHEKVMPQNLQNLTKEINDYFQQNYYYNLDDNSNYDDPYEE
SKVSQNHYNNNTQILNETFYGGIQIIKDIDYFFTQAHRSSNDNIDLFSLKQNYINLHQDC
INYQEMSDDKFTEASQYFLKNPLPAIEALSSPTANQLFLCHDKNWDEGKLDLNRIKRVSN
MRFIKVNQDVKLYEYMISEQSKIYNVYVPIGFENKDYQQNVKQKHINEIQTKILHLKKQA
FMLELEMKENFQQSTQDYVTDEYIETIKLFISQNDLKNYLRTFKDGLALHILIQEIYNDR
SNEVMQYQQKNKKEIEVNDFTHSLLYRVGTRWINELSLKLPQLKKIVVTENLAKCENKLQ
VEMLKRKNLENSNREKKQFQSKQLADVVESVTGALASKCGLFTAREFLMKKYNLLEFSVE
QYNEKLNELQLSSTSIYKVEQFKEKIDKVESILGYTFKYKEILLQALTHKSTKESLQNQA
NQENYNDYERLEFLGDSILNFLVAQHFFLTTQDKPDDFKPKQLHKSKTSIVNNVILSLIV
IEKGIYESIIYNQLSEQFKTQFEAYVQTVKKKVAIVPTKILAEMKEANIDNDEQAEMFIS
QGNNKNVVDNVYKKFIEQADKKLNPSKYRLNEDDLDDLSSDEELKEDGEVDINNLPITLT
QKCKFLKDYVIDLDDLYKFSLKIFGDIFESIIGAVFIDSKCLQTTSDVLFRLLQPYMVVY
ADIKSAQDHKRTTLLELWNSKNYAKRIKISHINTKTANEVQFKGKAGSMVVFKMTFKKDE
KNKIRTFYKEFLEFITSFIKAFESQNSKEHQTEEAMISHIDQYSKKWHAKAQQQKRDELI
KQKRENERLAGNQYAESKIYQQNNSSNVIINQNCIQIQ