Identifiers and Description

Gene Model Identifier

Contig10253.0.0.g3

Standard Name

QTRTD1

Aliases

Contig10253_0_0_g3

Description

Queuine tRNA-ribosyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01702 ) Queuine tRNA-ribosyltransferase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004055500.000000009996807949091551tRNA-guanine transglycosylases
, various speci...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10253.0.0.g3(coding)
ATGGAGCAATTAGCAAAAAAATCATTCATGCGAGTCGTTCTCACAGTTGAGAAAGCCAGG
AAACTGGAAATTAACTTCAGAAATAATCAGACTATGCTCACTCCCAACTTTATAATGACT
ACTAAAGGTGGAGCACTGAACGGAATAATAAAGCACAATCTGAAAGAAGTAAATTATCAA
GGAGTGTCCCTGAATTTCCACGATATGTACGATTACTTCCCAACATTGGCAAAGTACAGA
GAGCATCTAGAAAAATTGAATGCTGATTTGTTATAAAATAATTAGCAAAACAACCAGAGT
GATGAGTAGAAATTAGAGCAATAGCATGCCAAAAACCCATTGAAGAGATACTTTAATTTT
GATGATAAATTGGTTATGTTCTCACCGTTCAGTTATTCAGTTGATAAAGAAAAAGTTTCA
GGGTTCAATGACGAAACTCATTTCCAGGTTAATTTCAGACATAAGGTCCATGTTGACAAA
TACTTCGAATTTGCTTTGCAAAACACCCCAGATATGATAGTATCTCCCTGTGAACAAGTA
ACTTTCACCTCTGGCAAAAAGAAGAGAAAGAGATCATAAAAAGCAGCCCTAAAAAATTTC
GAGCAATTCTAAAAACTTATCAAGCAACATTAAGATGAGAAATAGAATGAAAACTCAAGT
GACATGGCACTTTTAATGCCGGTATTATTAGGGGATGATGATGGACTAGATTCCTTCGAG
ATGAAAATGCTTGAAAAGTAGTTCTCCTCAGACAACGAAGATAATCACCTCAATTATCAA
GGATTTATGATATATGGAACTGATTAACTAGTTGCACCTTCTGCTTATTAAGAAGTTAAG
AATTTAATGGAGAAGTTACCATAAGATAAAATTAGAGCAACTCATGGTCAGGGATCAACA
GTTGAAGTTTTGAATGGTATTTTATCAGGTCTAGATATATTTGAATCTGACTACCCACTC
TCCCTAGCAGAGCAAGGAATCGCAATTTTAATAAAAGACTTCCAATTAATACCTTAAAAC
GAAGAAAACCCCAAGACCCCTGCAAAATCTTACCTTGAACTTTCAAAGCAACTTCAATCT
AAAAATCAGAGAACTCTCAAGCTTTCTCTCGAAGAAAATAAAGATAATCATGCTAAATTG
GTTGAGGGATGTGATCAAAGAAATGAACGCTAATATTCTCATTGGAATTCACAATGTATG
GCAGTATGA


>Contig10253.0.0.g3(protein)
MEQLAKKSFMRVVLTVEKARKLEINFRNNQTMLTPNFIMTTKGGALNGIIKHNLKEVNYQ
GVSLNFHDMYDYFPTLAKYREHLEKLNADLLQNNQQNNQSDEQKLEQQHAKNPLKRYFNF
DDKLVMFSPFSYSVDKEKVSGFNDETHFQVNFRHKVHVDKYFEFALQNTPDMIVSPCEQV
TFTSGKKKRKRSQKAALKNFEQFQKLIKQHQDEKQNENSSDMALLMPVLLGDDDGLDSFE
MKMLEKQFSSDNEDNHLNYQGFMIYGTDQLVAPSAYQEVKNLMEKLPQDKIRATHGQGST
VEVLNGILSGLDIFESDYPLSLAEQGIAILIKDFQLIPQNEENPKTPAKSYLELSKQLQS
KNQRTLKLSLEENKDNHAKLVEGCDQRNERQYSHWNSQCMAV