Identifiers and Description

Gene Model Identifier

Contig13534.0.g87

Standard Name

QRSL1b

Aliases

Contig13534_0_g87

Description

Amidase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • carbon-nitrogen ligase activity, with glutamine as amido-N-donor (IEA) | GO:0016884

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003614504.9988726541653934e-26Amidase family protein
SGDYBR208C4.0009493637353324e-18DUR1,2 SGDID:S000000412, Chr I
I from 642210-636703, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13534.0.g87(coding)
ATGAAGAAATTTGTTTTTGAAAAGTAAAGTCTAAAGCAAATAGCTTTAGATTTATAAAGC
AAGAAAACGACTGTATTTTAGCAAGCCGAAAAGTCTTTTGAGAGAATTATGAAAACAAAA
GAACTGAACTATTTCACTTATTAAGACCCTCAATAAATGGTCGCATTATTAACTCAAGCA
CAAAAAGCTTATTCTAATGGTACAAACAGGCCACTTGAAGGGATTTTAGTTGGAGTGAAG
GACAACATAGATATACAGTATATACCAACTACAGCTGGCAGCAAAATCAAACAACTATAA
CGAAGTGGACCTCTTTAAGATAGCAGCTTGTGGCATTAGTTTAGAATAAATGGTGCGATT
AATGCTGGAAAAACAAACATGCATGAATTGGCATATGGCACTTCAGGCTTAAATGTGAAT
TATGGAAACATGCTAAATCCTCATGATATTACTAGAAGTACAGGTGGATCGTCAGGAGGA
TCAGCAGGGCTTGTTGGGTCTGGTGTGCTCCCGCTTGCTCTGGGAACTGACACAGGAGGT
TCCATTAGAATTCCAGCTGCATGGTGTGGAGCTGTTGGATATAGGCCAACTATAAATGCA
TGGCCAGCTGATTATGGTGTTAAATGTTCAAACATTCGAGATTCTATTGGGCCAATAGCA
AGTTCTGTTGAGGATATTATTTTTGTTCATGAAATAATGACAGGTTAGAAGATAGAAGCA
ATTGACAAGCACTCTAATTCCAAACTTAGAATAGGATTAATCATGGATCAATATTTTTCT
GATTTAGACCCTTAAATCGAAAACGCAATGAACTAAGCTATAAAAACTCTTTCAAAATAG
GGGGTTGAATTCTATGAAATAAATTACCAATCAAAATCCAATTTCTAACTCTCGGAAATT
ACAAGTAAAATATTAAGTTATGAAATGCCAGAACTCATTAGCTCATACTTTCAAATCAAC
TAAAAATAGCTTAATACTTAAGAGTTTATAGATGATACTAAAAATGAGGATACGAAGACA
TTTTTATAAAAGATTTTTACATTAAAAGATGAATAAAGCTTCTACAAAGCAATTAATGAG
AGGAAAATTGTATGCGATGAATATCATAAATTATTCTAAGATAATAGATTGGATGCTTTG
ATTTACCCTACTTGTAAAATGATGCCATTTAATTTCTCTGAATTAAAAAAGCTAGTTACC
TATTGGTTTAGAAATTTAATGTTAAAGTGGAGATGA


>Contig13534.0.g87(protein)
MKKFVFEKQSLKQIALDLQSKKTTVFQQAEKSFERIMKTKELNYFTYQDPQQMVALLTQA
QKAYSNGTNRPLEGILVGVKDNIDIQYIPTTAGSKIKQLQRSGPLQDSSLWHQFRINGAI
NAGKTNMHELAYGTSGLNVNYGNMLNPHDITRSTGGSSGGSAGLVGSGVLPLALGTDTGG
SIRIPAAWCGAVGYRPTINAWPADYGVKCSNIRDSIGPIASSVEDIIFVHEIMTGQKIEA
IDKHSNSKLRIGLIMDQYFSDLDPQIENAMNQAIKTLSKQGVEFYEINYQSKSNFQLSEI
TSKILSYEMPELISSYFQINQKQLNTQEFIDDTKNEDTKTFLQKIFTLKDEQSFYKAINE
RKIVCDEYHKLFQDNRLDALIYPTCKMMPFNFSELKKLVTYWFRNLMLKWR