Identifiers and Description

Gene Model Identifier

Contig19519.0.g1

Standard Name

QRSL1a

Aliases

Contig19519_0_g1

Description

Amidase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYMR293C9.99860868304602e-64HER2 SGDID:S000004907, Chr XII
I from 856793-855399, Gen...
T. thermophilaTTHERM_003614003.9983110956465888e-22Amidase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19519.0.g1(coding)
ATGGTCACAAAATTCCCTAATACAATAAAGCAAGTTTCTTAGCTTTACAAATCAAGGTAG
CTTAGAGTTTCTGATATGATTGATAAGACTTATTAGCAAATTTAAGATAAATCTCGTCTT
AACGCATTTGTCACTGTCCAGGAGAGAGCAAAATTAGATTAGTAAATTAATGAATCTCAG
GAAAGGCATGAAAAAGGAAATCAATTGTCTGAGTTAGATGGTGTTCCTATTGCAATAAAA
GATAATATTTTAGTAAAAGAGTTGCCAAGTACAGCAGCTTCAAGAATACTTCAAAATTTT
ACCCCATAGGTTGATGCTACAGTCATTAAGAAGTTAAAAGCCGCAGGAGCAATTATAGTA
GGGAAGACCAATATGGATGAGTTTGGAATGGGATCACTTGGAACGTATGGCTATGATTAG
AAGAAAATAGTAAGAAATCCAATAGATTCGGACTATATAGCAGGAGGTAGTTCTTCTGGA
AGTGCAGCTGCTACTAAATCTTAGCAATCAGTTGTATCTCTTGGAACAGACACTGGAGGT
TCAGTCAGCTATCCAGCTCATTGTTGTGGGTTATATTCAATGAAGCCATCATATGGAAGG
CTTTCAAGGTATGGTTAAATTCTATATTCTTCATCAAATGATGTGATTGGTCCAATGACT
AACAGTGCTGAAGATCTTGAAGTAATGTTTAATATCATGCAAGGTTAAGACTCAAACGAT
TCGAATTGCATAGATTTCTCTAAAATACACAATATCAGAGATTAAAATAGAATCACAAAT
TCAGATTATTCCATTGATAACAAGTAGCTTAGAGTAGGAATAGTAAGGGAATTTGATATT
GAAGAACTAGATGATAGAAATCGCAACATACAGAATACTTTGCAAGACATTTTCAAGGAC
AAAGAGATAAAGATGGTAGACATTTCAATACCACTTATTAAATACGCTCTTCCATTCTAC
TTTACCTTAGTCCCATCTGAAGCATCTTCAAATCTATCGAGATATGATGGGCTAAAGTAT
GGTTACTAGATACCTATAGGCTTAAAAGAAAATCAATCTCAAAAATAAGATCTCTATGAT
TACATTGAGAGAATAAGAAGCGAGGCATTTGGATTGAATGTTAAGAGAAGAGTTTTATTG
GGGAACTTCTTGCTTTCATCAAGATTTAGTGATTTCAATGAGAAAGTGATTGAAGCTTAG
AAAGTCAGAAGATTGCTTATTGATCAATACTGCAAAACTTTTGAATAGAACAATCTTGAT
TTCATTATATCTCCGGTCTCTATAGGAATTGAGCCACCTAAGATCGATGAAGTATTAAAC
AGCTCTAATAGTGCTACCAAGAATCCAGTTTATGAATATAAAATGGATTATTATACTGCA
TTGCCCAACAGTTTAGGCATTCCAGCAATCACATTACCAGTCCACGAGGACAGGCCAAAA
TATAAATTCCCTTCAAGTTTTATGTTGCAAGGATATTTTGGAGAAGATTATCATCTATTA
AAAATTGCTAAGTTAATAGATAAGGAATTAAGCGCAAGAAATATCAATGTTAATTAATGA


>Contig19519.0.g1(protein)
MVTKFPNTIKQVSQLYKSRQLRVSDMIDKTYQQIQDKSRLNAFVTVQERAKLDQQINESQ
ERHEKGNQLSELDGVPIAIKDNILVKELPSTAASRILQNFTPQVDATVIKKLKAAGAIIV
GKTNMDEFGMGSLGTYGYDQKKIVRNPIDSDYIAGGSSSGSAAATKSQQSVVSLGTDTGG
SVSYPAHCCGLYSMKPSYGRLSRYGQILYSSSNDVIGPMTNSAEDLEVMFNIMQGQDSND
SNCIDFSKIHNIRDQNRITNSDYSIDNKQLRVGIVREFDIEELDDRNRNIQNTLQDIFKD
KEIKMVDISIPLIKYALPFYFTLVPSEASSNLSRYDGLKYGYQIPIGLKENQSQKQDLYD
YIERIRSEAFGLNVKRRVLLGNFLLSSRFSDFNEKVIEAQKVRRLLIDQYCKTFEQNNLD
FIISPVSIGIEPPKIDEVLNSSNSATKNPVYEYKMDYYTALPNSLGIPAITLPVHEDRPK
YKFPSSFMLQGYFGEDYHLLKIAKLIDKELSARNINVNQ