Identifiers and Description

Gene Model Identifier

Contig21385.0.g17

Standard Name

QARS

Aliases

Contig21385_0_g17

Description

tRNA synthetases class I (E and Q), catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00749 ) tRNA synthetases class I (E and Q), catalytic domain
  • ( pfam03950 ) tRNA synthetases class I (E and Q), anti-codon binding domain
  • ( pfam04558 ) Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000561409.997093137033517e-262glutaminyl-tRNA synthetase fam
ily protein
SGDYOR168W1.9991914687114462e-138GLN4 SGDID:S000005694, Chr XV
from 649303-651732, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21385.0.g17(coding)
ATGGAAGATACTAGCAGTAATTACTAAGCGACATTCTTGGCTATTGGCCTTGATCCTAAG
GTCGTAGACTCAATCACTAAGAATAAGAAAGTTTCCTTGAGACTCAAGGAGATTGTTGAC
CTAGCTGAAGTGAGAGAAACCTCAAAGACTATCGGAAATTTGTTGTACTAAGCCTCTACT
AAGATGCCAGAATCAATCACTCATCACACTAAGTTCCTTGTTTCCTACATCATTTCTGAG
TAAATAGTCAAGCCTCAATAGCTAGATGAAGCTATTAAACACTTAACTGATTTAGTGAGA
AGCAAAGGTGCTGAAGCTCCTATTGATGAAGAGGTTTTCAAGAGAGAATCAGGTATTGGT
TTCGTTATTAGCGACGAAGAAATCATATCTTTTGTCAATAAGATCTATGAGGACAGCATT
GCTACCATTAAGGAGTAGGGACACAGCTTTGACTTCAGCAAATTGATTTACAAGGCTAGA
GATGAAATGAAGTGGGCAGACCAAAAGAAAATCATTGATTTAATCAATAAAAGAAAGGTC
GAAATCTTGGCTGAAATTCCCAAGCCAGAAGGAGATGGAAAAGTCAAGAAAGCTAAGGCA
GCTCCAGCTAAGGTTGAAGAGAAAAAGGTAGAAGCTAATGCTGAACCTGCAGCAGCCTCC
ACTGGAAAGAATATTCTTGATTTAGTGGGAAGAGATATTAAGGCTGTTTAAAACTCTGAA
GCACTTCTAAAGAAACACAAAGAAGCTACTGGAGGAAGAATCGTAACTAGATTCCCTCCT
GAACCTAATGGTTTCTTGCACATTGGTCACGCGAAAGCTATGAGATTCAACTTCACAGTT
GCCTCAGAGAACGGTGGTTATACTTACTTGAGATTTGATGATACTAACCCAACTAAAGAA
AACCAAGAATTTATCGACAATATCAAGCTTTGCGTTGATTGGTTAGGTTATAAGCCTCAT
GATATCACTTATGCCAGTAACTATTTCGAAGAGTTATATGAACTTGCTAGAGAACTCATA
AGAAGAGGAAAGGCTTACGTTGAACACCAAACTAAGCTTTAAATTAACGAAGGTAGACAA
AAGAAGGAGGACTCACCATTCAGAAACAGAACTGTTGAAGAAAATCTTAAATTATTCGAA
TAAATGAGACAAGGTAGATTCGCTGAGAATGAATGCTGCTTAAGAATGAAAATCGATATG
ACTCATGAAAATCCAAACATGAGAGACCCAGTTGCCTATCGTATTAGATACGTAGCTCAC
CCACATGTAGGAAATAAATGGTGCATTTATCCAACTTATGACTACACTCATTGTATCAAT
GACTCACTCGAAAATATTACTCACTCACTTTGTACTCTTGAGTTTGAAAACAGAAGAGAG
TCATATTACTGGCTCTTGGAAGCTTTGGATCTCTACAGACCAATTGTTTGGGAATACAGC
AGACTTAATCTTACTTACACAGTTCTTTCAAAGAGAAAGCTTGAAAAGCTTGTTGCTCTT
AATGTTGTAGATGGTTGGTAAGATCCAAGAATGTTGACAGTCTTGGGATTAAGAAGAAGA
GGTTATACCCCATCAATGATCAACGATTTTTGTAATGAGATTGGTGTATCTAGAAAAGGT
AACGACAACATCACTCAAATCAAGCTCCTTGAGCACTATGCAAGAAAGGAACTCGATAGA
GATGCTCCAAGAACTTTCGGTGTTCAAGAACCAGTTCTTCTTGAAATTGTTAATTTTGAG
GCTGTGAAAGAGACTGAAATTGAAGCTCCACTTTTCCCAACAGATAAAGCAAAGGGATCT
CAAATTTATAAGCTTGGAAAGCACGTCTATATTGACTAGGAAGACTTCTCAGAAGTTCAC
TCAAAAGGATTCTTCGGTTTAACTCCAGAACAACCAGTGTGCTTGAAGTACGGTCCAGTG
ATAAAGTTGGTTGAAGTTGTTAAAGGTGCCAATGGTGAAGTGTCCCATGTTAAGGTTGAA
GTATTACTAGACTTCAAGGAGAAGCTCAAGGGTTACATCCACTGGGTCTCCAAAGATCAA
AGTGTTGATGCAGTTGTTAGACTCTATTCTTACTTATTCGATTGCGAAGAAGTTAAGGAT
TCTGATTGGGAGCAACATATTAACCCAGACTCACTTGTTATCAAAGAGAATGCTAAAGTG
TGGAAGAATCTTGAAAATGCAAAGGAGTATGATAGATTCCAATTCGAAAGACTTGCTTAC
TTTGTCGTTGATAAAGATTCACGCACTGAATCAGTTGGAGGAAAGCTCGTCTTTAACAGA
ATCGTTGAACTCAAGGAGTCAAAGGAGAAGAAAGTTAACCTTGGAAAGTGA


>Contig21385.0.g17(protein)
MEDTSSNYQATFLAIGLDPKVVDSITKNKKVSLRLKEIVDLAEVRETSKTIGNLLYQAST
KMPESITHHTKFLVSYIISEQIVKPQQLDEAIKHLTDLVRSKGAEAPIDEEVFKRESGIG
FVISDEEIISFVNKIYEDSIATIKEQGHSFDFSKLIYKARDEMKWADQKKIIDLINKRKV
EILAEIPKPEGDGKVKKAKAAPAKVEEKKVEANAEPAAASTGKNILDLVGRDIKAVQNSE
ALLKKHKEATGGRIVTRFPPEPNGFLHIGHAKAMRFNFTVASENGGYTYLRFDDTNPTKE
NQEFIDNIKLCVDWLGYKPHDITYASNYFEELYELARELIRRGKAYVEHQTKLQINEGRQ
KKEDSPFRNRTVEENLKLFEQMRQGRFAENECCLRMKIDMTHENPNMRDPVAYRIRYVAH
PHVGNKWCIYPTYDYTHCINDSLENITHSLCTLEFENRRESYYWLLEALDLYRPIVWEYS
RLNLTYTVLSKRKLEKLVALNVVDGWQDPRMLTVLGLRRRGYTPSMINDFCNEIGVSRKG
NDNITQIKLLEHYARKELDRDAPRTFGVQEPVLLEIVNFEAVKETEIEAPLFPTDKAKGS
QIYKLGKHVYIDQEDFSEVHSKGFFGLTPEQPVCLKYGPVIKLVEVVKGANGEVSHVKVE
VLLDFKEKLKGYIHWVSKDQSVDAVVRLYSYLFDCEEVKDSDWEQHINPDSLVIKENAKV
WKNLENAKEYDRFQFERLAYFVVDKDSRTESVGGKLVFNRIVELKESKEKKVNLGK