Identifiers and Description

Gene Model Identifier

Contig18774.0.g48

Standard Name

PYM

Aliases

Contig18774_0_g48

Description

Mago binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18774.0.g48(coding)
ATGGATCACCAACGCCAAGATAAATTCATACCAGCAACTCGCAGAGAAGATGGAACTTGG
CGGAAATCTCTAAAAGTAAAGCCTGGCTATACTCCGATGGAGGAAGTTGCCAAATATCAA
GCACCTCACCGTGTGAGAGAGTAACATAATTCTGGTTAAGGATGGCAAACGAATAACAAC
TAATAATAAAGTAGCAATTCTAACTTCAATGCTCGCTAGAGAAAATTTGAGTCGGAAGGC
ACTTTTAAACTAGAGGATGAAGAACTCTAGAAAATTCGTAGTAAAGCTCAATAAAAAGAT
AATTACTATGAAAAAAATGGTAAACTATAAAATAAAATGTCTATTACTGATAGTTAAGCG
TAGTTCAGTTCTTAACAAATTGGTAATGGACCTTACTAAAGCAATCTTAGAGATATGCCT
AGCATTAATGAGTCGCAAGCAAGTTTTTCTTATTAACCTAAAAAGCAATAGCTGCCCTTG
GAAAATAAGAATAAAGTTGATGCGATGATATCATCCTAACAGTCACAAAAATATCAATCT
GTTCAATAGTAATCAAAGATTAAATAGTCACAGTTACCCTCTGACTTCTCTTCTCAGAAT
CACCGTTAAGTCACGATTGCACAACCCAAGCCTGCCAGTCAATAAATAGAAACTGGCAGA
GATATTGAAGTGCAAATTGCGAAGGGCAAAAAAAAGTACCAGAAAAAAGTAGTGGTAACT
TCAAGCCAGCAATAGCCTTCAGTTTAAAATAAAACTGAAAGTTCTCAAAATGCAGTTTAA
AGTGTGAAGACATCTGAAAAGCTGCCAGATAACAGACTTTAACAATTCGAGGAGGAGAAG
GATATGGACGGGTCCACTAGTGACTATCAATTTGACTTGTCCTAATTAAACAACGAGATT
AATTAGGAAGAAAACTAGAAGGAAATAAAGAAGCTCGGAAAAAAGCTGAAGCAAATTGAA
AAGCTAGAGTAAGCTGGAAGAGAGCTTAATGAAGAAGAAAAAGCAAAATTAGCTGCTAAG
GATGAAATTGTTTAACGAATGGCTGAGCTTAATCTCAATTGA


>Contig18774.0.g48(protein)
MDHQRQDKFIPATRREDGTWRKSLKVKPGYTPMEEVAKYQAPHRVREQHNSGQGWQTNNN
QQQSSNSNFNARQRKFESEGTFKLEDEELQKIRSKAQQKDNYYEKNGKLQNKMSITDSQA
QFSSQQIGNGPYQSNLRDMPSINESQASFSYQPKKQQLPLENKNKVDAMISSQQSQKYQS
VQQQSKIKQSQLPSDFSSQNHRQVTIAQPKPASQQIETGRDIEVQIAKGKKKYQKKVVVT
SSQQQPSVQNKTESSQNAVQSVKTSEKLPDNRLQQFEEEKDMDGSTSDYQFDLSQLNNEI
NQEENQKEIKKLGKKLKQIEKLEQAGRELNEEEKAKLAAKDEIVQRMAELNLN