Identifiers and Description

Gene Model Identifier

Contig9904.0.0.g88

Standard Name

PWP2b

Aliases

Contig9904_0_0_g88

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYCR057C9.997093137033517e-262PWP2 SGDID:S000000653, Chr III
from 223228-220457, Geno...
T. thermophilaTTHERM_014622103.000071119766155e-172hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9904.0.0.g88(coding)
ATGCTTAAGATAGTAGTATTACTGAGACTTTATTGCTCTCGCCAATCTAATATCGACAGA
ATTGTGTTAAGTCCAGATAGAAAAACTTTGATAACAATCGATGTGGATGGCTTCGCTCTC
TTTATTAATTTCCCAAAACGTGTGGTAATCGCTCACTTCAATTTCAAGAACCCCGTGACA
GCTTTCGCTTTCTCTCCAGACTCTAAATTCTTCGTAGTTGCTACTAAAGGAGCTAAGGTT
AAGGTGTTTGAGGTGCCAAGCGTTGATCATAAAGTCTACAGTCCCTTGATTTTATATAAG
AAGTATGCTAATTTGCATAGTTAAGAGATTACTGGAGTCACTTGGACCACTGATAGCAGA
TTTTTCTTGACATGGAGTGAAGACCTCACTTTGAAGCTCATGAGTCTCCACAAACTCCCA
GGCTACCTGCCATTCACTTTTGGGGGCAATAAAAAGAAAATCGTAAACGCATTTTTCAAT
GAAGATAACACCCGTATATTCACAGTTTCCCAAAATGGCACAGTCCTGCTTTGGAAGTGG
ACAGATGAAAAAGGAGAGGGAGTGCAGAAAGTTCTTGAATTTTAATAGTTTAAGATGCAG
AAGAGACTTAAAACTGGGCCTAAAGAGAATGAATACATTCCAGTAGAGGAAGACATCTCA
CTCTATTCAGATTTTGAAAAGAAAATTACTTAAGGAAGATTTTTATTGGAGAAAAAAACT
AAATTTTAATTGCAAAATTAGGCCAAAGTCACTTCTTGTGATTACAACAGTAACATCCAA
GCAACTGGCAATAAAATCTTAGTTATTGGATAAAGTAATGGTGTGTTTGCTCTTTTCAAT
ATGGATACTTTAGAATCATTACATTCATTCCAAATTAGTGAGAATAAGATCAACAGTATA
TCAATCAATACTTCAGGTGAGTGGATAGCTCTGGCAAGTAGAGAACTCGGTCAATTATTT
GTATGGGAATGGAAATCAGAGACTTATGTAATGAAGTAGCAAGGTCATTTCTTCGATTTA
AATACAATTGCATACTCCCCAGATGGTGCTTTAATTGCTACAGGTGGAGATGATGGTAAA
GTCAAATTATGGACTACTAAAAATTGCCTATGTTTTGTCACTTTCAGTGATCATACTGCC
CAAGTCACTGATCTCAAGTTTATCCCAAAGAAGGGCAATGCAGTTTTGAGTTCAATTTTA
CAAGCTTTGAAACTCACCTAATTCACCTGTCTTTCTATTGACAGCACTGGAGATTTAGTT
TGTGCTGGTGCTATGGACCCATTTGAGGTGTACATTTGGAGTTTGAGAACAGGATAGTTA
ATAGATACTCTCTCAGGGCATACTGGACCAATTTCATGTGTTTAATTTGCTTAGCAAGGT
TCACTGTTGGCTACTGGAAGTTGGGATCATACAGTCAGAGTCTGGGACATCTTTGAGAAG
AAAGGCATTATTGACACTCTTAGTCATTCAAGTGAAGTAATTGCAGTAGATTTCCATGCT
AACAATAAGGATATGGTCTCAACCACATTAAGTGGGCAAATGTATATGTGGTAAGCTGAT
GAAGGCCACTTGATTGGAACAATTGATTGCAAGAATGATTTGGCAGGTGGACGTATGAGA
GACGATAGAACTACTGCTAAGAATTCTACTAAGAATAAGCATTTTAACTCAATTGCTATA
AGCCCTAATGGAGATTTCATTATTGGGGGTGGCAACTCTAAGAATATCTGTCTCTATGAC
ATGAGGTTCAAATTAATGATCAAAAGATTCGCAGTAACTCAAAATCGTTCTTTGGACGGT
GTCCTACAAATTTTGAATTCAAAGCATGTCTCAGGGGAGGCAGGTGTCGCAGACCACGAA
CTTGATATCGACAGCGACCTAGAGGAGGATGCTTGGTAATTCAGAAATCAGGCTGATTCA
AACTTACCAGGAGCTAAGAAGCCAAATAACGCTCAAAGTATCAAGAGAAATACCAAATTA
GCTGTCAGAATCAAGAAAGTATTATTCTCACCAGATGGAACCCAATTTTCTTGTGCTACC
ACAGAAGGATTGGTTATTTACAGCTTGAGAAACGACTATTAAGTTTTCAACCCAGTTGAC
ATCGATGAAAATGTGACTTTAGATAATATCATATAGTGCGTGAAAAAAGAAGAATACCTT
CCAGCACTCTTGATGGCTTTGAAAATCAATGAAATAGAAGTTATAGATAAAATTTATAAG
TGCATCCCCTTAGAAAACGTTCCTTTAATCTCTGCCCATTTCCCCTCAAATTACCTATTC
AAATTTTTGGATTTCCTTGCACATGAGCTTGAAAAGGGTAAAGACCTAGAATGGACCATG
ATTTGGATTAAAAACTTGCTGAAGTATCAAGAGCAAGCTCTAAAGAAATACAAAGAACTT
GGCCAAGGAGGCAAGGGCAGATCCCTCATGCTTAAAATCTACAGTGGCTTATAGTTTTAT
GATAATAGCGTTAAGAAAATAGCTAATGAAAACATGCATATGATGAAGTTTATGATTAGA
ACTGCTGAGTTTAGAAAAGAAGAGTCAACTACTGAACAAGAGCAAGAATTGGAATGA


>Contig9904.0.0.g88(protein)
MLKIVVLLRLYCSRQSNIDRIVLSPDRKTLITIDVDGFALFINFPKRVVIAHFNFKNPVT
AFAFSPDSKFFVVATKGAKVKVFEVPSVDHKVYSPLILYKKYANLHSQEITGVTWTTDSR
FFLTWSEDLTLKLMSLHKLPGYLPFTFGGNKKKIVNAFFNEDNTRIFTVSQNGTVLLWKW
TDEKGEGVQKVLEFQQFKMQKRLKTGPKENEYIPVEEDISLYSDFEKKITQGRFLLEKKT
KFQLQNQAKVTSCDYNSNIQATGNKILVIGQSNGVFALFNMDTLESLHSFQISENKINSI
SINTSGEWIALASRELGQLFVWEWKSETYVMKQQGHFFDLNTIAYSPDGALIATGGDDGK
VKLWTTKNCLCFVTFSDHTAQVTDLKFIPKKGNAVLSSILQALKLTQFTCLSIDSTGDLV
CAGAMDPFEVYIWSLRTGQLIDTLSGHTGPISCVQFAQQGSLLATGSWDHTVRVWDIFEK
KGIIDTLSHSSEVIAVDFHANNKDMVSTTLSGQMYMWQADEGHLIGTIDCKNDLAGGRMR
DDRTTAKNSTKNKHFNSIAISPNGDFIIGGGNSKNICLYDMRFKLMIKRFAVTQNRSLDG
VLQILNSKHVSGEAGVADHELDIDSDLEEDAWQFRNQADSNLPGAKKPNNAQSIKRNTKL
AVRIKKVLFSPDGTQFSCATTEGLVIYSLRNDYQVFNPVDIDENVTLDNIIQCVKKEEYL
PALLMALKINEIEVIDKIYKCIPLENVPLISAHFPSNYLFKFLDFLAHELEKGKDLEWTM
IWIKNLLKYQEQALKKYKELGQGGKGRSLMLKIYSGLQFYDNSVKKIANENMHMMKFMIR
TAEFRKEESTTEQEQELE