Identifiers and Description

Gene Model Identifier

Contig925.1.g116

Standard Name

PWP2a

Aliases

Contig925_1_g116

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam08662 ) Eukaryotic translation initiation factor eIF2A
  • ( pfam04003 ) Dip2/Utp12 Family
  • ( pfam07433 ) Protein of unknown function (DUF1513)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_014622109.997093137033517e-262hypothetical protein
SGDYCR057C9.997093137033517e-262PWP2 SGDID:S000000653, Chr III
from 223228-220457, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig925.1.g116(coding)
ATGATAAATTACAAATTTTCGAACTTAGTTGGTACTGTGTACAACAGTGGGAATATTTTA
TTCGCAGAGCAGAAAAATGCTTAAGATAGTAGTATTACTGAGACTTTATTGCTCTCGCCA
GTTGGAAATAAAATCACTGTGTTTGACTTAACTAATAATGTCAGTCAGACTTTGCCATTC
CAGAATAGATCTAATATCGACAGAATTGTGTTAAGTCCAGATAGAAAAACTTTGATAACA
ATCGATGTGGATGGCTTCGCTCTCTTTATTAATTTCCCAAAACGTGTGGTAATCGCTCAC
TTCAATTTCAAGAACCCCGTGACAGCTTTCGCTTTCTCTCCAGACTCTAAATTCTTCGTA
GTTGCTACTAAAGGAGCTAAGGTTAAGGTGTTTGAGGTGCCAAGCGTTGATCATAAAGTC
TACAGTCCCTTGATTTTATATAAGAAGTATGCTAATTTGCATAGTTAAGAGATTACTGGA
GTCACTTGGACCACTGATAGCAGATTTTTCTTGACATGGAGTGAAGACCTCACTTTGAAG
CTCATGAGTCTCCACAAACTCCCAGGCTACCTGCCATTCACTTTTGGGGGCAATAAAAAG
AAAATCGTAAACGCATTTTTCAATGAAGATAACACCCGTATATTCACAGTTTCCCAAAAT
GGCACAGTCCTGCTTTGGAAGTGGACAGATGAAAAAGGAGAGGGAGTGCAGAAAGTTCTT
GAATTTTAATAGTTTAAGATGCAGAAGAGACTTAAAACTGGGCCTAAAGAGAATGAATAC
ATTCCAGTAGAGGAAGACATCTCACTCTATTCAGATTTTGAAAAGAAAATTACTTAAGGA
AGATTTTTATTGGAGAAAAAAACTAAATTTTAATTGCAAAATTAGGCCAAAGTCACTTCT
TGTGATTACAACAGTAACATCCAAGCAACTGGCAATAAAATCTTAGTTATTGGATAAAGT
AATGGTGTGTTTGCTCTTTTCAATATGGATACTTTAGAATCATTACATTCATTCCAAATT
AGTGAGAATAAGATCAACAGTATATCAATCAATACTTCAGGTGAGTGGATAGCTCTGGCA
AGTAGAGAACTCGGTCAATTATTTGTATGGGAATGGAAATCAGAGACTTATGTAATGAAG
TAGCAAGGTCATTTCTTCGATTTAAATACAATTGCATACTCCCCAGATGGTGCTTTAATT
GCTACAGGTGGAGATGATGGTAAAGTCAAATTATGGACTACTAAAAATTGCCTATGTTTT
GTCACTTTCAGTGATCATACTGCCCAAGTCACTGATCTCAAGTTTATCCCAAAGAAGGGC
AATGCAGTTTTGAGTTCAATTTTACAAGCTTTGAAACTCACCTAATTCACCTGTCTTTCT
ATTGACAGCACTGGAGATTTAGTTTGTGCTGGTGCTATGGACCCATTTGAGGTGTACATT
TGGAGTTTGAGAACAGGATAGTTAATAGATACTCTCTCAGGGCATACTGGACCAATTTCA
TGTGTTTAATTTGCTTAGCAAGGTTCACTGTTGGCTACTGGAAGTTGGGATCATACAGTC
AGAGTCTGGGACATCTTTGAGAAGAAAGGCATTATTGACACTCTTAGTCATTCAAGTGAA
GTAATTGCAGTAGATTTCCATGCTAACAATAAGGATATGGTCTCAACCACATTAAGTGGG
CAAATGTATATGTGGTAAGCTGATGAAGGCCACTTGATTGGAACAATTGATTGCAAGAAT
GATTTGGCAGGTGGACGTATGAGAGACGATAGAACTACTGCTAAGAATTCTACTAAGAAT
AAGCATTTTAACTCAATTGCTATAAGCCCTAATGGAGATTTCATTATTGGGGGTGGCAAC
TCTAAGAATATCTGTCTCTATGACATGAGGTTCAAATTAATGATCAAAAGATTCGCAGTA
ACTCAAAATCGTTCTTTGGACGGTGTCCTACAAATTTTGAATTCAAAGCATGTCTCAGGG
GAGGCAGGTGTCGCAGACCACGAACTTGATATCGACAGCGACCTAGAGGAGGATGCTTGG
TAATTCAGAAATCAGGCTGATTCAAACTTACCAGGAGCTAAGAAGCCAAATAACGCTCAA
AGTATCAAGAGAAATACCAAATTAGCTGTCAGAATCAAGAAAGTATTATTCTCACCAGAT
GGAACCCAATTTTCTTGTGCTACCACAGAAGGATTGGTTATTTACAGCTTGAGAAACGAC
TATTAAGTTTTCAACCCAGTTGACATCGATGAAAATGTGACTTTAGATAATATCATATAG
AGCGTGAAAAAAGAAGAATACCTTCCAGCACTATTGATGGCTTTGAAGATCAATGAAATA
GAAGTTATTGATAAAATCTACAAGTGCATCCCCTTAGAAAACGTTCCTTTAATATCTGCC
CACTTCCCCTCAAATTACCTATTCAAATTTTTGGATTTCCTTGCTCATGAGCTTGAAAAG
GGCAAAGACTTAGAATGGACCATGATTTGGATTAAAAATTTGTTGAAATATCAAGAGCAA
GCTTTAAAGAAATACAAAGAACTCGGCCAAGGAGGCAAGGGCAGATCTCTAATGCTTAAA
ATCTACAGTGGCCTACAGTTTTATGATAACAGCGTTAAGAAAATAGCTAATGAAAATATG
CATATGATGAAGTTCATGATTAGAACTGCTGAATTTAGAAAAGAAGAGTCAACTACCGAA
CAAGAGCAAGAATTGGAATGA


>Contig925.1.g116(protein)
MINYKFSNLVGTVYNSGNILFAEQKNAQDSSITETLLLSPVGNKITVFDLTNNVSQTLPF
QNRSNIDRIVLSPDRKTLITIDVDGFALFINFPKRVVIAHFNFKNPVTAFAFSPDSKFFV
VATKGAKVKVFEVPSVDHKVYSPLILYKKYANLHSQEITGVTWTTDSRFFLTWSEDLTLK
LMSLHKLPGYLPFTFGGNKKKIVNAFFNEDNTRIFTVSQNGTVLLWKWTDEKGEGVQKVL
EFQQFKMQKRLKTGPKENEYIPVEEDISLYSDFEKKITQGRFLLEKKTKFQLQNQAKVTS
CDYNSNIQATGNKILVIGQSNGVFALFNMDTLESLHSFQISENKINSISINTSGEWIALA
SRELGQLFVWEWKSETYVMKQQGHFFDLNTIAYSPDGALIATGGDDGKVKLWTTKNCLCF
VTFSDHTAQVTDLKFIPKKGNAVLSSILQALKLTQFTCLSIDSTGDLVCAGAMDPFEVYI
WSLRTGQLIDTLSGHTGPISCVQFAQQGSLLATGSWDHTVRVWDIFEKKGIIDTLSHSSE
VIAVDFHANNKDMVSTTLSGQMYMWQADEGHLIGTIDCKNDLAGGRMRDDRTTAKNSTKN
KHFNSIAISPNGDFIIGGGNSKNICLYDMRFKLMIKRFAVTQNRSLDGVLQILNSKHVSG
EAGVADHELDIDSDLEEDAWQFRNQADSNLPGAKKPNNAQSIKRNTKLAVRIKKVLFSPD
GTQFSCATTEGLVIYSLRNDYQVFNPVDIDENVTLDNIIQSVKKEEYLPALLMALKINEI
EVIDKIYKCIPLENVPLISAHFPSNYLFKFLDFLAHELEKGKDLEWTMIWIKNLLKYQEQ
ALKKYKELGQGGKGRSLMLKIYSGLQFYDNSVKKIANENMHMMKFMIRTAEFRKEESTTE
QEQELE