Identifiers and Description

Gene Model Identifier

Contig14793.0.g111

Standard Name

PUSL1

Aliases

Contig14793_0_g111

Description

tRNA pseudouridine synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002188300.000000000007000776811212012tRNA pseudouridine synthase fa
mily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14793.0.g111(coding)
ATGAGAACCTCTATTAATCCATATTCCAGGCGATACTTGGCTTTATATTCCTATAATGGC
TCTTAATATCACGGAATGCTGAACCCTGTTGAACCTAATGTCAATAAAAAAGGAATTTTA
AATGTCATCGAAGACTCACTTTAGAGATTCAATAAAAAGCAGTATAATATTGCTACTAAA
ATAAGAGGAGCCAGCAGAACAGACGTGGGAGTGCATGCACTCTGCAATGCCTTTACTTTT
GACGCAAGCGATGATCATGAAAATAGAAAACTTTTTCAGACAGAAGATTTGAGGAGAGGG
ATGAATGCACACTTTTCCATGAATTAAGAGAAAATACAAATAAATTAATTGCATTTATTA
AAAGATCCATGGTTCGACTGCAGAGGTGCTCCTCTTGAAAGAACTTACATCTACAAGATT
ATTCTGACAAACGATGGCCCTATGGGATATAGTTGCCCACATACTATGTTTCTTAAGGAT
TTTGCTTGGAACATAAATTCTTCAGAAATTAATTTGGACAAATTTATGGAAGGAGCTAAA
TTGTTCGAAGGTACTCACAGTTTCAAGCATTTTGTTAAGATCAAGTTAGATGAGGTAAGT
TTGGCCAGTTTATCAAAGTTATGA


>Contig14793.0.g111(protein)
MRTSINPYSRRYLALYSYNGSQYHGMLNPVEPNVNKKGILNVIEDSLQRFNKKQYNIATK
IRGASRTDVGVHALCNAFTFDASDDHENRKLFQTEDLRRGMNAHFSMNQEKIQINQLHLL
KDPWFDCRGAPLERTYIYKIILTNDGPMGYSCPHTMFLKDFAWNINSSEINLDKFMEGAK
LFEGTHSFKHFVKIKLDEVSLASLSKL