Identifiers and Description

Gene Model Identifier

Contig21759.0.g27

Standard Name

PUS9

Aliases

Contig21759_0_g27

Description

RNA pseudouridylate synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005227101.0001801308941382e-55ribosomal large subunit pseudo
uridine synthas...
SGDYDL036C4.000521932330652e-52PUS9 SGDID:S000002194, Chr IV
from 388901-387513, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21759.0.g27(coding)
ATGCAAAAGAGTATATACTACTTTAAAAATGGGTTGAGATTTGTCAATAGTTATCCACAT
TAATTTGTTGCTTTTGGCAAGAAAAGATGGGTAAGTCAACAGCTTTATGATGTTTACTGC
AGAGAATTCTTATCAAACACCCCTGAATACTACAAAGAGGCAATTCTAGATGGCAGAATC
ACGGTTAATGGCAAGAGAGCTTCTTTATTTCACAAAATACAAGAAACTGACAAAATTGTA
CACACAGTGACAAGAAAAGAAGTACCAGTGATTGACTAAAAGATTGATATAATTTACGAA
GATTAGAATTACATTTGTGTGGATAAGCCAGCTTCAATGCCAGTGCATGAAGTCGGGATG
TTTAAACATAATTCATTATTAGGTATATTGGAGAACGAGCATAAATACAAAGGATTGAAG
ACTATGCATAGACTGGATAGATAAACTTCTGGGATTGTGTTCTTTGCTAAAAATGTCAAG
GCAAACAATGAATTTAGGGATTAACTAGATAATGATAAAGTTTAGAAAGTCTATCTAGCT
AGAGTAGAAGGTAATTTTCTTGAGTAGTAGAAGGCATCAGAAGTAAAAGTAGAAAAATCA
GTCTACATTAAGAGTCATAAGGAAGCTCTTTATGCTTGTGAAGATGAAGATAAGTTAACC
GAAGAGCAAAGAAAAACATCCAAGACAGCAGAAACTGTTTTTAAATTTATGTTCTTTGAT
GAGAAATTACCCTAACTCATTTTACGTTTCCCTAAAACAGGTCGAACCCATTAAATTAGA
CTGCATTTGAAAGCTCTTGGTCACCCTATAGCAAATGATAGAGCTTATGGTGGAAAATAT
TTGAATAATGGAAATTTAGAAGAATTCGATGAGAAGGATTTTGAGGGAATTTATCATAAC
GATGATTACAAAGGGAAAGAGAACTTATTCTTGATTTTGTGGTTGCATGCTTATAAATAT
ACTTATAGAGAGATTGTAGCTAAGACCAAGATTCCAAAGTGGGCTGAGAAAGATTTTGAA
ATAAAGCAAATTGATGAAGTTATTAATGAGCAATAGATAGTATGA


>Contig21759.0.g27(protein)
MQKSIYYFKNGLRFVNSYPHQFVAFGKKRWVSQQLYDVYCREFLSNTPEYYKEAILDGRI
TVNGKRASLFHKIQETDKIVHTVTRKEVPVIDQKIDIIYEDQNYICVDKPASMPVHEVGM
FKHNSLLGILENEHKYKGLKTMHRLDRQTSGIVFFAKNVKANNEFRDQLDNDKVQKVYLA
RVEGNFLEQQKASEVKVEKSVYIKSHKEALYACEDEDKLTEEQRKTSKTAETVFKFMFFD
EKLPQLILRFPKTGRTHQIRLHLKALGHPIANDRAYGGKYLNNGNLEEFDEKDFEGIYHN
DDYKGKENLFLILWLHAYKYTYREIVAKTKIPKWAEKDFEIKQIDEVINEQQIV