Identifiers and Description

Gene Model Identifier

Contig18150.0.g42

Standard Name

PUS7

Aliases

Contig18150_0_g42

Description

tRNA pseudouridine synthase D (TruD)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01142 ) tRNA pseudouridine synthase D (TruD)
  • ( pfam08283 ) Geminivirus rep protein central domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYOR243C1.999129405549486e-73PUS7 SGDID:S000005769, Chr XV
from 792241-790211, Genom...
T. thermophilaTTHERM_005403501.0004460510701209e-64tRNA pseudouridine synthase D

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18150.0.g42(coding)
ATGGAAAGTTTAGAAAATAATCAGTAAAAACCTTCAGATTAACCTTTAGATTAAAGTTCA
AACCTTATAGCTAACTATTCAAGCTAATCTGAATTTGGGGAGTATGAAGCAGGCATCTAA
GAGTTTTTGTCAAAAGATAACACTACAATTACTTGCGTGATAAAGCACAGATTTGGAGAT
TTTATCGTCAATGAAATTGATGAATTTGGAAATGTTGTGTACTGCACACCTGAGAATGAT
ATCTAAAAATGGAGAAAGGGAAATGCTGCAAATGTTGAAGGTGGATTACCAACCGAGCAG
CAATTAGAAGAAGGTGTTTTGACAGCTGAGGAGTAAAAGCAACTTGAAATTTAAAACGAA
CAGAAGGAGTTATAATTGCCAGAAGATAAGATAGAGAAGCTTAAATCCTTAATCGATGAA
GAGGACTTCAATAGATTCATAGACTACATATAAAGAATCAAAGAAGGTTCATATGAAAGA
ACTGAGATATTTCAATTCAATAACTCAATCGATGATAAGACTAGAAGATCGCAAGTTCAT
TTGTTTTTCAAGAATGAAACTACCATTTTTGAAACTGATACAGATATGACCAAAGGCCCT
GACTCAAGATTAATCAGAGTGTTCTTGAAAAATGCACTCAGTTAAAATAAGAGGAGAAAG
ATGAATATTGTTGAGAGAAAGCCTTAAGGTTAAGTGGAAAACTGGCCTCAATATTTGCAA
GTTGTAGTTTAAAAGACAAATGTTGACACTATGCAAGCAGTACATTATATTGCCAAGAAA
CTCAAGAAATATGGAAAATGCTTCTAAGTTTGTGGTAACAAAGATAAGCGTGGAATCACT
ACTCAAAGAATGACTATATTGAGAGATTGGGACAAGAAAATGAAGGTTGGCACTTTTTCA
AGAGTTGACAAGCCACTAAGACTTGGATAATTGAGTGGAAATAGATTCTCGGTGGCATTA
AGATTTATACCAGCAAGTGTAACTAATGAATAAATTGCTTAAAATGTCGAAAATTTGAGA
CTAAAAGGTTTCCTGAACTATTTTGGTATGCAAAGATTTGGAACTTATAACATTAGGACT
CATCAAATCGGAATTGAAAACTTGAAATAAAATTGGCAGAAAGTCGTTGAAATGATTCTT
TCTCAACATCCTGATGGAGATTATTTTTCTTAACAAAGAAAATAAAAGATGGTTAAATAT
GTAATCGAAGATAAGAATATTGATGGTGCAATGAACTTGCTTGATAGAAGAGATAGACTT
GAAAAATCGCTCTTAATGATATTGAAGAGAAATCCTAATGGATATTACAATGCATTCCAA
AATTTAGCAAGAAATACAAGAACTATCTTCATTCATGCTTATCAATCTTATCTTTGGAAT
TAGACCTTATCGGAGAGAATTAGAAGATTTGGCTCTGAAGTTTTAATTGGAGATTTGGTC
ATTGATCCAGAAAAGAGTAAATTGGTTGAAGAGGCTGATAATGCAGAGGAGCTTCCAGCA
GATGAAAACATTGACGATGATGAAGAACCTTATGACCTTCCAGTATTCGATAAGCTTAAT
AAAGAAGAAAGTAAGCAACCAAAGAAGCCTAAACTTCATGGTTCAGCTGCCCTCGAAGAA
TTACTGATAGAAGTGACTGAAGAAAACATTCATAAGTACAGGATTGAGGATGTAGTGCTA
CCAATGATTGGTTACAAGACTCAATTCCCAACAAATAAGGATCTTTTACAGATCATGTAT
GATATCATGTCTAAAGACAACATCACTCTGGACCACTTCGAGAGATAAGCCACCCTCGAT
ACTTAAAGTGCTTATGGCTCATATAGAAAGATTATTGGATTCGCCACTGACCTCGAATAT
GATGTTGTAGAATTTTAAAACATCAATGAAGACTTATTGACTCCTAATCACAACATTGAG
AAAGACCCTATTCCTACAATCAACCGAGAAGATTAAACTCAACCTATTCATAGAGCTATC
AGAATCAAAATGAATTTGAAATAGAGTTGCTATGCTACTATGATGATCAGAGAAGTTGCC
AAGATGTCAAGCGCTTTCAATGTTCAAAATGCTATGAGCAAAGAAGTCAACAAGTGA


>Contig18150.0.g42(protein)
MESLENNQQKPSDQPLDQSSNLIANYSSQSEFGEYEAGIQEFLSKDNTTITCVIKHRFGD
FIVNEIDEFGNVVYCTPENDIQKWRKGNAANVEGGLPTEQQLEEGVLTAEEQKQLEIQNE
QKELQLPEDKIEKLKSLIDEEDFNRFIDYIQRIKEGSYERTEIFQFNNSIDDKTRRSQVH
LFFKNETTIFETDTDMTKGPDSRLIRVFLKNALSQNKRRKMNIVERKPQGQVENWPQYLQ
VVVQKTNVDTMQAVHYIAKKLKKYGKCFQVCGNKDKRGITTQRMTILRDWDKKMKVGTFS
RVDKPLRLGQLSGNRFSVALRFIPASVTNEQIAQNVENLRLKGFLNYFGMQRFGTYNIRT
HQIGIENLKQNWQKVVEMILSQHPDGDYFSQQRKQKMVKYVIEDKNIDGAMNLLDRRDRL
EKSLLMILKRNPNGYYNAFQNLARNTRTIFIHAYQSYLWNQTLSERIRRFGSEVLIGDLV
IDPEKSKLVEEADNAEELPADENIDDDEEPYDLPVFDKLNKEESKQPKKPKLHGSAALEE
LLIEVTEENIHKYRIEDVVLPMIGYKTQFPTNKDLLQIMYDIMSKDNITLDHFERQATLD
TQSAYGSYRKIIGFATDLEYDVVEFQNINEDLLTPNHNIEKDPIPTINREDQTQPIHRAI
RIKMNLKQSCYATMMIREVAKMSSAFNVQNAMSKEVNK