Identifiers and Description

Gene Model Identifier

Contig18928.0.g26

Standard Name

PUS3

Aliases

Contig18928_0_g26

Description

tRNA pseudouridine synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01416 ) tRNA pseudouridine synthase
  • ( pfam10105 ) Uncharacterized protein conserved in bacteria (DUF2344)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYFL001W3.999627495270728e-67DEG1 SGDID:S000001895, Chr VI
from 147131-148459, Genom...
T. thermophilaTTHERM_001811005.9995872346509964e-61tRNA pseudouridine synthase A
family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18928.0.g26(coding)
ATGGAATCGACATAAGATAATCATCTACATATTTCTAATTAATCTAATTAATTAGAATAA
AATCAAAATTCATTAGCAAATGACAAAGAAGTTGCAGAGTAACTGGAAAATGATTAGAAC
AATAGCAATTTTCATTACTCTAAAATTAATTTGACTGAGAAATCTTTGACTCTTGATCAC
TTATCAAAATTCAACAAAGAAGATCTGATTAACCTGATAATTGAAAACAAACAAAAGTTG
ATCCCTCCTAAATCCCACCATAAAATATTCAACTAGAGATCTTTTGACTTTTCAAAGCAC
AAATAAGTGAAAATTGCATTTAAGTTTAGCTACCTTGGGAAAGATTACAAAGGACTGGCA
ATTTAAACAAATACTGATGAAACTATTGAAGGCAGAATATTTGCTGCTTTGAAGAGAGCT
TGCCTAGTGCAACCAGATATTCCTATTTTCAAGAGTTAATATACAAGGTGTGGCAGGACT
GACAAAGGGGTATCAGCGCTTGGGAATGTATTATCACTCTATGTCAGAAAACTTAAAGAT
GATAACTACTGTTAAGTGTTAAATCATTGCCTTCCAGCTGATATTAGAATGATTTCTTTC
TCTGAAGTGCCAGCACATTTTGATTCCAGGTTTTCTTGCATTTACAGAGAGTACAAATAT
TTCTTTGTGTAATAAAACATGAACATTGAGAAGATGAAACAAGCTGCAAGAAAGTATTTA
GGTATCCATGATTTCAGGAATTTCTGTAAGAAAGACGAAAGCGTCAAACTAGAAGATGAC
GAAGATGATTAAAATTTCATGAGACGTATTTACAGATTTGATATTGTACAGTAACATATA
AATGTACAAAATGAAAAATTATCAATTTGGCATGTTGTTATCAGAGGAAGTGCTTTCTTA
TGGCATCAAGTCAGATGTATGATGGCTGTGCTTTTTATGATAGGAAGAGGTGAGGAGGAT
GAATCTGTTATTGATTTGTTATATGATATTGAGAAGTTACCAGAGAGACCAAATTACAAT
ATTGCATCTGAATTTGGGTTGATTTTGAATGAATGTGGCTTCGATGATATCGAATGGAGC
AACCCAGTTTTCGCAAATGTAGAGACTTATAATGTATTTAGAAAGCAGTATGAAGAGAAT
GCTATTGATATGAGTCTCAATGAAATAATGCTAAAGTACTATGAGTAAACATTCTTATCA
TCACAGCAAATCTTACAAAGTTAAGGCATTTAAATAGTCAATAGAGAATTACTTACTTAA
AACGAATAAGTTTCTTGGAATTAAATGCTAGGTGCGATAACTATGAGAAGAAAAGAAAAA
TAAGATTCGTCAATTATCAGAAGAGCAGCTGAAGGCAAAAATTTACCAATGAGCAAAAAG
AGAGAAAAGAAGTTTAATGATAAACAAAAGTAGCAAGAGCAGCATTAGTAACTGCAAATA
GAATAGTGA


>Contig18928.0.g26(protein)
MESTQDNHLHISNQSNQLEQNQNSLANDKEVAEQLENDQNNSNFHYSKINLTEKSLTLDH
LSKFNKEDLINLIIENKQKLIPPKSHHKIFNQRSFDFSKHKQVKIAFKFSYLGKDYKGLA
IQTNTDETIEGRIFAALKRACLVQPDIPIFKSQYTRCGRTDKGVSALGNVLSLYVRKLKD
DNYCQVLNHCLPADIRMISFSEVPAHFDSRFSCIYREYKYFFVQQNMNIEKMKQAARKYL
GIHDFRNFCKKDESVKLEDDEDDQNFMRRIYRFDIVQQHINVQNEKLSIWHVVIRGSAFL
WHQVRCMMAVLFMIGRGEEDESVIDLLYDIEKLPERPNYNIASEFGLILNECGFDDIEWS
NPVFANVETYNVFRKQYEENAIDMSLNEIMLKYYEQTFLSSQQILQSQGIQIVNRELLTQ
NEQVSWNQMLGAITMRRKEKQDSSIIRRAAEGKNLPMSKKREKKFNDKQKQQEQHQQLQI
EQ