Identifiers and Description

Gene Model Identifier

Contig101.1.g83

Standard Name

PUS1b

Aliases

Contig101_1_g83

Description

tRNA pseudouridine synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01416 ) tRNA pseudouridine synthase
  • ( pfam10173 ) Mitochondrial K+-H+ exchange-related

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL212C1.999598840915195e-17PUS1 SGDID:S000006133, Chr XVI
from 153149-151515, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig101.1.g83(coding)
ATGTTAATGAATAAATTTAGCCGTACAATAACCTCAAAACTTAATTAAAAATATTGCGGG
GCTATTGCTAAGACTTTTTCGAGAAATTTCAGCTTGGCATTTACTGATATAGATGGAATA
GTTGAATAATAATTAAGAAAAACCGATTGGCGAAACTTCCTTTTTATTTATGGTTTTGAT
GGTAGCAAATATGAAGGCTCAACTTACACTGGAGGCATGAAAACTGTTGAAGGGGGATTA
CTGGATGCATTTGTCAAGTCTGGCTTATTAAAGAAAGAAAATATTGGAGAAAGTAAATTA
GAGCTATCAAGAACGTCGAGGGTAGATAAACATGTCTCTGCTTTGTCATGCGTGTTGAGA
GCTAGAATGCCAATTAAGTATTCGCCAGAGAAAATTGCTTAGATGATTGAACCATTTCTA
CCTGATGATATCTTTTTGCATGAGATCCAAAAAACTGATAATAGAGGAGACATAAAAGAA
TAAGTTGAGAAACGCTTGTACTATTACTACCTCCCAACCTTCTGCCTATTCAGCCCAGAC
CAGCATAAATAAATGTAAAACTTAGACTTAGCTCCAATCTTAAACCCTGCTAAAGAGCTT
TTCGATTAAAAACTCAACAGGCATGTGACTAAATAAACTTTAATAGAAATTATGAATAGA
GAAGAACATCAGTCAATTTTCAATTAGCTATACTAAACTAAAATTGATAATTTGAAAAAT
GAGATTATCTAAAATTTCAATGAAACTTTGCAACCCTTATACATAAATGAAGGAAAATGG
TATCACAACTTTATAAGTCAAAAACACGCTGGTGCCTATAGAAATAAATAAGTAGCTTTC
CAGAGTAACTTTAGAAAAATTGATAAATTTGAAATTGATCAGCTCATTACCCTGCCTCAC
TCCATAAATCCAAACTTAGATGTTTAACCTATCCAATTTGTGAGATTTAATATAGAGGGA
CAGTCCTTTGGTCTGCAATAAATTCGTAATATGATTGCTTCTGTCATGGAAATTTATTCA
GCTTAGGGCAGTTTAGAGTTACTACAATAATCTTTTGACAAAAAGAATGTTAAGAAATTT
ATTAAAGCACCAAGTCAAGGCATTATGCTAAGAGAAGCAGTATTCCAAAAAATTTAAAGG
AAATAAAGCACAGAATTCTAAGCAATTTAAGCTTCAAATGAGTAATTTTAAAAGGAGGTT
GTACAAGAAAAGCATGAAGACTATACATAAATTTAATATTCCGATTTGACTTACGATAAG
ATGAATGAACTTTAAAGCCATTTAGAAAATTAAATCCATTCTTAGGAATTTAACCACAAA
GAATTCACTTTTCACTATATGCAATAATTGGCATAAGTTGATAGAACTTAAGCGCTGAGT
AAGAATGTGTACTTGAATGAGGACTAATTCAAGAAGTTAAAGGATTACAAGAAATTTGGA
TATTTAAAGAAAAATGAGAAATTAAATGTAATTAAGACTGATTAAAATCAAATTTAAGAT
GCAAAATGA


>Contig101.1.g83(protein)
MLMNKFSRTITSKLNQKYCGAIAKTFSRNFSLAFTDIDGIVEQQLRKTDWRNFLFIYGFD
GSKYEGSTYTGGMKTVEGGLLDAFVKSGLLKKENIGESKLELSRTSRVDKHVSALSCVLR
ARMPIKYSPEKIAQMIEPFLPDDIFLHEIQKTDNRGDIKEQVEKRLYYYYLPTFCLFSPD
QHKQMQNLDLAPILNPAKELFDQKLNRHVTKQTLIEIMNREEHQSIFNQLYQTKIDNLKN
EIIQNFNETLQPLYINEGKWYHNFISQKHAGAYRNKQVAFQSNFRKIDKFEIDQLITLPH
SINPNLDVQPIQFVRFNIEGQSFGLQQIRNMIASVMEIYSAQGSLELLQQSFDKKNVKKF
IKAPSQGIMLREAVFQKIQRKQSTEFQAIQASNEQFQKEVVQEKHEDYTQIQYSDLTYDK
MNELQSHLENQIHSQEFNHKEFTFHYMQQLAQVDRTQALSKNVYLNEDQFKKLKDYKKFG
YLKKNEKLNVIKTDQNQIQDAK