Identifiers and Description

Gene Model Identifier

Contig20508.0.g59

Standard Name

PUS1a

Aliases

Contig20508_0_g59

Description

tRNA pseudouridine synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01416 ) tRNA pseudouridine synthase
  • ( pfam14362 ) Domain of unknown function (DUF4407)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPL212C7.996975020896894e-36PUS1 SGDID:S000006133, Chr XVI
from 153149-151515, Geno...
T. thermophilaTTHERM_000114506.002144168983342e-19tRNA pseudouridine synthase fa
mily protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20508.0.g59(coding)
ATGAAAAGATCAGCTGAGCAAGACGTAGAGGCTTTAGAGCAATAAGTCAATCCTAAACAA
ACAGAATAAATCAACTAGCAACAAGAAGAAGTCAAGAACAGTAATTAGACAGAGTAAAAT
ACCAATTAAACTGATAAAAAAGATGAAAATATTGATAAAAAGTAGGAAAGCAAATTGCCT
AAATGTCGTGTGGCTATGATTGTCGGATATAATGGCAGTAATTTCTGTGGATCTCAGAAG
AACCCCAATATTCGTAGTGTTGAAGAAGAAATCGAGAAAGCTCTGTACAGGTTAGGAAGA
ATCTCAGAGTATAACTATGGTGACCTGAAGAAAATCGGTTGGAACAGAGCCACCAGAACT
GATAAAAGAGTGCATGCAATCCAAAACTGCTTCTCCTTTAAAATTCACATTAGTAAGGAT
GAGAACGAAGACGAGGACTTCAGAGTTGTATTGAACAAGGAACTTCCTGAGGATATCACT
ATTTTCGCTATAATTAGGTCAAGCAATAGGTTCAACAGCAAGTTAAACGCAGATGATAGA
GAATATTCCTACTATTTGCCCACTTTTATGTTGAAAAGCATCAAATAAGGGTGGTATGGT
TCAGGTATCAACAGGAAAATTCAGGCTGCTTAGTTGAGAGGCAATAAAGCTGAAGGTGTT
GTTGCTGGTACTGAGGAGGAGAAGAAAGAAGATGATAAGCCAAAGGGAATTAAATTTATT
AGACGTGATCCAAATAAGAAGAAAAATGAGGATGGATTAGATAATGACGATGATGAAGAG
GGAAATAATGATGTTGAGCAATATCAAGACTTGTATTTATTCAGAAACATTGATCACATT
CCTCAATCCGAGTTTGACTTGCTCTACTCCTACAGACTATCCAAGGAAGATCACGAGAGA
GTGATTGCTCTTTTTAAGTTATTCCTAGGTGTGAAGAAGTATCACAACTACACCAAGTTG
ATCAGAGCACATATGATGAAAGCCTAAAGATTTATGATGATTCTTGAAGCAAGTGATTTC
ATGTATGTAAACTACGAGACCAATGAAGTCACTAACAAAGAAGATCCAAAAGCAATTGAA
TTCCTGCATTTCGCACTCAAGGGTTAGTCTTTCCTGTACAACCAAATCCGTAAAATGATC
GGTGTCATTATTCAAGTATTCCGTGGAGACTTGGACGATAAATTTATACCAAACACTCTC
AGAGACAACATAGTTAACGTCGCTTTGGCTCCAGGTGATGGTCTGTTGTTGGAGAAAGTC
TGCTACGATAAGTATAACACCAACAAGAAAGATGTCAAAAATGAAATTATGATAAAGTAT
GTGGCCACAACCAATGAAATCAAGCAATTCAGAGAGAACTTAGTCAGACACATTGCCACA
AGGGAGACTGTTGATAAAGCTTTTACTAAGTGGTTGAGTTAGTTCGATGATTATAGCGAG
GATTACTATGTTGAGAGGCCACCTCAAGCTGCAAAACTACTCATCAGAGAGTGA


>Contig20508.0.g59(protein)
MKRSAEQDVEALEQQVNPKQTEQINQQQEEVKNSNQTEQNTNQTDKKDENIDKKQESKLP
KCRVAMIVGYNGSNFCGSQKNPNIRSVEEEIEKALYRLGRISEYNYGDLKKIGWNRATRT
DKRVHAIQNCFSFKIHISKDENEDEDFRVVLNKELPEDITIFAIIRSSNRFNSKLNADDR
EYSYYLPTFMLKSIKQGWYGSGINRKIQAAQLRGNKAEGVVAGTEEEKKEDDKPKGIKFI
RRDPNKKKNEDGLDNDDDEEGNNDVEQYQDLYLFRNIDHIPQSEFDLLYSYRLSKEDHER
VIALFKLFLGVKKYHNYTKLIRAHMMKAQRFMMILEASDFMYVNYETNEVTNKEDPKAIE
FLHFALKGQSFLYNQIRKMIGVIIQVFRGDLDDKFIPNTLRDNIVNVALAPGDGLLLEKV
CYDKYNTNKKDVKNEIMIKYVATTNEIKQFRENLVRHIATRETVDKAFTKWLSQFDDYSE
DYYVERPPQAAKLLIRE