Identifiers and Description

Gene Model Identifier

Contig19920.0.g100

Standard Name

PUFX5

Aliases

Contig19920_0_g100

Description

Pumilio-family RNA binding repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00806 ) Pumilio-family RNA binding repeat

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL014W9.999888128184441e-42PUF4 SGDID:S000002982, Chr VII
from 466141-468807, Geno...
T. thermophilaTTHERM_005358900.0000000039998859049333245Pumilio-family RNA binding rep
eat containing ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19920.0.g100(coding)
ATGAATGGAAAAAATTCATTCAATGGAACTAATTAAAACATGAGTGGACTAAACATTCCA
CTTAAAAGCCTCAATATCAGTCCTAGGGGCTCAGAGGACTGCGGATTGCTCCAAAAATTA
AGATTAGAATATTCATATGAGAGATGTGATGATCACTCTGACTAAAATTAAAATAATGAT
GAGTTTTGCATGAAAAATAATATTGATGAGTAATCTAAGCGTAAAAACTAGACTTACCAA
GAGGAGGCTTCTATCACAAATGATCTATAGTTTGGGAGATAAGATAGCAATTAAGCTCAA
GAAAATGTGGAGAAGATAAAATACAGCCCATTCAATAAACTAAGTGAAAATTAATTGCAG
ACATCCTAACAGAGAATCAGCAATTTTCAATTGAACTCAGACTCTAAGGATGATGATTTT
ACTTCAGCTTTTTCAGAGTGTTTCAGCTCATCTATCCTCTCCTCAACACAAAACTAAAGA
GGCAGCAGTGGTGATTACTAGCAAAACTAATGGAACAATGGAGTGCTAAGCTAAAATCCA
TGGAGCTAGTTCTATCAATCAGACTTCAAGAAGCCTTGGATGAACATGAACAGCGGCAGC
TTCGGCGGGGGACCCCTTTCAACCTCTTCACAGACAACTCATGATGACGAGAATGAAATA
TAAAAATCAAAATTGAGTGATTCAAATTAAAATTTAAGCAGTAGTATTAATGCTAAATAC
AGCTAATTTTGCCAAAAGTAAGATAAAAGAGATGGATTGGTTCATAAAAGCAAAAACATA
AAGACAGTTCAAGAATCTTCCTTAAACACCAGTGGGTCTTCTTTTACTGAAGAAATTTTC
AATACTGCCTTAAGTAACTTAGAATTCTTAAGTGATGAAGATTCTCTTGATAACATAGAG
GTAGGAAGAAAAAACTCATAAATTGATAGAGAAACTGTAAAGATTAATGAGTTCAATCCT
AATGGCAACATGATATTTTTAGATAAATAGATGTCAACTTACGGTTAAAGTGAAGTATAA
GGTCTTTCAAACCTCACTCCATTTTTAATGAGTGCCTATGACTAATTGTCAAGAGAAGAC
CAAGAAATTATCAATCAAGCTGATTTCTATTGCTACGACTAGGCTGGTTGTAGAATGCTA
TAAAAGAAGCTCGATGAGGACTGCCAAGAATAACTTTTTAAGCAAGCTCTTATAATGAGA
TTAATGCCACTTTTCTAAGATATCATGGTTGATCAATTTGGAAACTACTTGACCTAAAAA
ATCCTCGAGTTAGCTTCAATCATGGAAATAAAGCAAATCATAAATCAAGTCTTGCCATCA
ATTAATGACATTGCGATGACAGTTCACGGAACAAGAGCTATTCAATTTCTCGTTGACATT
TTAAACATGAATTTAAAGTACTTAGACACTGATGTTTTAAACATTATTGAGCAACTCAAG
TTATAGATTAAAGAACTGAGTTTAAGTGTTCATGGAAATCACGTTATCTAAGCTTTTCTC
TGCGTATTCAGATCTTCTTAAAACCCCGAGGATTAGGATCAAGAAGGCTCCGAAGTCTTT
TAAAGATATACTTAGTTCATCTTTGATGCATGCATAAACGATTGTATTGAAATTGGCTCT
CACAAGCATGGATGCTGTGTCATGTAAAGATGCCTAGAAAAGGGTAGAGAAGTGTAAAAG
CTTGCTTTAGCTGATGTAATTATATATAACCTGCATTCTCTGATTGAAGACCCATATGGA
AACTACCTTGTCCAAAATGTACTCAAGTTGAACAACGTTGATAGAAACGATCAAATCTTC
CAGATGATAGGAAGTGACTTCATAAGACTCAGCTAGCTAAAGTTCTCCTCTAACGTAATT
GAAAAGTGTCTTGAAAGCAAGATGAAGAATGTTACAGTGGATATGATCTTGTTAGGATAA
ATCATCAATGATGATTAGACTGTACTAAGAGACTTGGGTTATTAATTGTCCAAAAATAGA
GTTACAAGAATAAACTTTATCGTAGACAATCTTATCTTCCATCAATTCGGAAACTATGTT
CTTCAAAAGATCATCACAATAATCAAGAATGATTAACTTAGAGTTATTATTCTACAAAGA
ATTGGCCAGCTATCTGGAGATTTACAAAGAACCAAACATGGCCAGAAAGTGTTGTAAAAA
CTACAAAAAACTTATCCACATGTTTTCAACTAATATTGCACAAACCAAAATCAAACCATG
CTGTCTAACTTCTAGCTTAATAACCAAAGCTTTATTCAAAATGATTCTTAAGTCTTCAAC
TAACATGCTAAGACTGCTCAAAGAAAGTTCTCTCATTTGTCTAATACTAGTACTGGAAAT
AGCTCAACAAACAGCACCTGCACAAACCAAAACAACTATAGCAACACTTAATATCAACCT
AAGAATAATTCTTACTTTGTGAGAACAAACAGCAACAACAGCGATTACAGCTAAAACTAC
TAAAATCAGTACACAATAAACAATAATAACAACGGAGGGTATTACTATCAAGCAAAATAT
TGA


>Contig19920.0.g100(protein)
MNGKNSFNGTNQNMSGLNIPLKSLNISPRGSEDCGLLQKLRLEYSYERCDDHSDQNQNND
EFCMKNNIDEQSKRKNQTYQEEASITNDLQFGRQDSNQAQENVEKIKYSPFNKLSENQLQ
TSQQRISNFQLNSDSKDDDFTSAFSECFSSSILSSTQNQRGSSGDYQQNQWNNGVLSQNP
WSQFYQSDFKKPWMNMNSGSFGGGPLSTSSQTTHDDENEIQKSKLSDSNQNLSSSINAKY
SQFCQKQDKRDGLVHKSKNIKTVQESSLNTSGSSFTEEIFNTALSNLEFLSDEDSLDNIE
VGRKNSQIDRETVKINEFNPNGNMIFLDKQMSTYGQSEVQGLSNLTPFLMSAYDQLSRED
QEIINQADFYCYDQAGCRMLQKKLDEDCQEQLFKQALIMRLMPLFQDIMVDQFGNYLTQK
ILELASIMEIKQIINQVLPSINDIAMTVHGTRAIQFLVDILNMNLKYLDTDVLNIIEQLK
LQIKELSLSVHGNHVIQAFLCVFRSSQNPEDQDQEGSEVFQRYTQFIFDACINDCIEIGS
HKHGCCVMQRCLEKGREVQKLALADVIIYNLHSLIEDPYGNYLVQNVLKLNNVDRNDQIF
QMIGSDFIRLSQLKFSSNVIEKCLESKMKNVTVDMILLGQIINDDQTVLRDLGYQLSKNR
VTRINFIVDNLIFHQFGNYVLQKIITIIKNDQLRVIILQRIGQLSGDLQRTKHGQKVLQK
LQKTYPHVFNQYCTNQNQTMLSNFQLNNQSFIQNDSQVFNQHAKTAQRKFSHLSNTSTGN
SSTNSTCTNQNNYSNTQYQPKNNSYFVRTNSNNSDYSQNYQNQYTINNNNNGGYYYQAKY