Identifiers and Description

Gene Model Identifier

Contig14243.0.g66

Standard Name

PUF6

Aliases

Contig14243_0_g66

Description

CPL (NUC119) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR496C4.9976494746363024e-29PUF6 SGDID:S000002904, Chr IV
from 1443403-1441433, Gen...
T. thermophilaTTHERM_004749003.0002687256732656e-20hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14243.0.g66(coding)
ATGGGAGAAGACAAAAATAGCAAAAAGAGAACTTTTGATAAGATGAAGCTAGCTCAGAAC
CAAAAAGGAGGCATGGGTGCTGAATAGAACGGAGGAGAAGGACCTCGCCGTAGAGACAAC
AAAATGATGCAAAAGAAGTCCAAGCAAGAGAGAGGAAATAGTAGAGTTGTTGAAAAAGAG
GACAATAAACAAATGGGTATTAACGCTATCGAGAAAAGAAGAGCTAAGGAACACAATCAA
GTTGAAGTTGTGAGACAAGAAGACCCAGGTAGATTTGAAAAGAAGGGTGGTTACAAGGGC
AAACAAGCTCAAGGTCCAGGTATGACCAGAAGACAAAAGTAGAAGGTTTCAGACTTAATC
TTGAAATTAAGAGTGAACTATAACAAACTCTTGATCAAGAAGAAGGAATAAAAAATGGAG
AAGGGTGAGAAAGTTGCTCTTGTCGAGGAGAGTATCGAATTGGTTGGAGCTAGATTTAAG
GAACTTTTGTACAAACATGATGGATGCAGAATATTGCAAGCTTTGTTAAAGTATGGAAAT
AAGGCACAGAAAACTAAGGTCATTGATAATATCAAGGAGCACTATTTACATATTATGACT
CAAAAATACTCTCACTATTTAGCATCAAAGGCCTTTTTACATGCTCCTATGCCAGAATAG
AAAACATTTTTCAGAACTTTGGTTTCAGCAGAAATCAATAAATACATCATACATGCTTAT
GCATCTGAAGTTATTGAATACATTTACACATTATCTACAGACTAAGAGAAGAGAGAAATG
GTATTTTCTTTCTATGGAAACTTCTTCTTGCTCTTAAAAGAAGTTGAGCATGATGGCAAA
GCACCAAAACAAATTACATTAAAAGAATTTTTGGATAAGAAGCCTCAATTATAAGAGCAA
ATTATGCATAAACTTGAAAAAGTATCAACCAAAGTTGTTGAGAAGGGTCTTACCAGACAT
ACCATCGTTTAGGCAATCCTTTATGATTTCTTCCAAACTTCTACTGACATTGATAGACTA
AGAAATTTAGCCGATTCAATGAAAGAAGCCCTTCCCTCTCTTTTATCTTCATACAAAGGT
CTGTATGTAGCTTGCGCTTCCTTCAGTCTTTTGGATGCAAAGGACAGAAAAGTTGTCATT
AAAAGTTTAAAGGATGACTTGAAAGAGATGCTTACCAACAAGATCTCCCATTTGTTCATC
ATTCATATTCTCAACAATCTTGATGATACTCAACTTTCAAAGAAAAAGATCATCTCTGAG
ATCTTGAAATCCATCGATGAACTTATCAGCGACAAATATTACCAGTAAGTAATCATCGGT
GTCCTCTAACCTAGCAGCAAGCGTTATTTCTTACCAGAGGAGATTGAAGCCTTCGAAGCT
CATAAGGACAACACCTCAAGCAAAAAATCAGAAGTCGTTCGTAGACAAGAACTCTTGAAA
TGCCTACTTAAGCCACTTGAAGCTTTCTTTGAAGAGAACTTAAGTTACTACTTACTCGAA
ATAAACAAGAACATGATCCTGAGATGTTTGTTACAAGCAATCATTGAAGTTGGCTGTGGA
GAGGAGCATCAAGATTTGATTGATGAGATGTTCAGACAAATTCAAAAGAAACAAGCTTAC
GAAAAGGAAGGCGATGACAAGGGCATTCTTTTAGGTCATCCAGATCTCCATAGAGTCCTT
AAGGAGTTAGTTAAGCAAGAGAGAGAACAAGAGACTACCTCAAAGACTTTAACTTTCAGC
AATATTGTTGGATCTGTATTGGTAAAGAATTTCGATGATGTTATTAAGTCAAGAGCTGTC
TTTATTCTTTTGGAGTTAATCGAACATGAAGAGACCAAGGATATCGTTTACGATTAAGTC
AAGAAGAGAAAGAGTGATATTCAAAAGATTTTCAAAGAGCTACCTAAAGCTAAGGGTATT
GAAATCCTTCTTAAGAAGCTTTGA


>Contig14243.0.g66(protein)
MGEDKNSKKRTFDKMKLAQNQKGGMGAEQNGGEGPRRRDNKMMQKKSKQERGNSRVVEKE
DNKQMGINAIEKRRAKEHNQVEVVRQEDPGRFEKKGGYKGKQAQGPGMTRRQKQKVSDLI
LKLRVNYNKLLIKKKEQKMEKGEKVALVEESIELVGARFKELLYKHDGCRILQALLKYGN
KAQKTKVIDNIKEHYLHIMTQKYSHYLASKAFLHAPMPEQKTFFRTLVSAEINKYIIHAY
ASEVIEYIYTLSTDQEKREMVFSFYGNFFLLLKEVEHDGKAPKQITLKEFLDKKPQLQEQ
IMHKLEKVSTKVVEKGLTRHTIVQAILYDFFQTSTDIDRLRNLADSMKEALPSLLSSYKG
LYVACASFSLLDAKDRKVVIKSLKDDLKEMLTNKISHLFIIHILNNLDDTQLSKKKIISE
ILKSIDELISDKYYQQVIIGVLQPSSKRYFLPEEIEAFEAHKDNTSSKKSEVVRRQELLK
CLLKPLEAFFEENLSYYLLEINKNMILRCLLQAIIEVGCGEEHQDLIDEMFRQIQKKQAY
EKEGDDKGILLGHPDLHRVLKELVKQEREQETTSKTLTFSNIVGSVLVKNFDDVIKSRAV
FILLELIEHEETKDIVYDQVKKRKSDIQKIFKELPKAKGIEILLKKL