Identifiers and Description

Gene Model Identifier

Contig22789.0.g9

Standard Name

PUF3c

Aliases

Contig22789_0_g9

Description

Pumilio-family RNA binding repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00806 ) Pumilio-family RNA binding repeat

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLL013C3.0012565309061457e-65PUF3 SGDID:S000003936, Chr XII
from 124714-122075, Geno...
T. thermophilaTTHERM_005584908.998068369452149e-53Pumilio-family RNA binding rep
eat containing ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22789.0.g9(coding)
ATGGACAAAAATTCTTTCAACCTTCCTCAAATAAGCGGTTTGGGGAGTTAGGGGTTCGTA
CCTCCGTTTGAGCAGCTTCCTATACTTATTACTTAGGATTCAGGGAATTCTGATTTCGGA
GCTTAGGGCTGTGTGGGTGGATTCGAAAAGCAGCATTAATCTGATGATCCACGAGGAGGC
GTAGAAACATCAGGTGGATAGGAGCAATAACTAATAGGTACTCTCTTACTTGACGATGAT
GATGATAACGATTCAATCTTTCCAAAGGCAGGCAACTTCCAGCACACTCAAGGGACCAGG
TACCCCTAGAACACACGTGGCCAGTATAGCATGAACCACAAGCACGAGGGATCTATCTAA
AACGGAATTGATTTCGGAGATTAAGATTTAAATCCAGGCTTTGGGTTAGGCCTACACAAA
CAGAGATCAACGAGCGAGAAATAAATAGGAAACTTTTCTGTAGTTAATCAGACTGCAAGT
ACTTAGAACTACTCACACAATTTGCAATTTGGAGTGATTGATCCAGACTATAAGTACTCT
AATGAAGGGATAGGAGGTAGAGTGAGCAAAAACAACATTGGGATTTTGGACGACGTGGAA
GATGGCCTGAACATTTCTCAGAGGAGCTCATCCCAGTATTTCAACAATGAAAGCCATATT
CATGAGCTAAATTACGAATAAAAGATATTTTCTGAGGGCCAATCTTTTCCAATTGGTTAC
CAAAATAATAATAATGCACCACTCAAATTACAATCAAATTAGTAAAATTAGCAATCATCC
TACATTCAGAACTTTAATCAAAATTCTTAAATGGCTTCAATCATAAAAAATGAGAACTAT
ATGTAAGGAAACATGCTCTCCGAAGATTAAATCAAATAAATTCATTACTAGAACTAATTG
GCTGAGCAAAGGCAGAATAAGAATGTATCTAATTTTTCAGAAAGCCCATTTTAACATGCA
GACGATTTCAAGAGCGATCAATCAGATTCATATTCTTACGGAAAAGATATCAATAATAAT
TTACTCAATAATGCGAATCCTTTCATCTCATAAACTATGCCTCCTAGAAGATAAGAAAGC
TAGCAACAATTTGGCTAAAATTAAAGATAAGGAGGTATTGAAGACATGATTTAGCAGTAG
TTTAGCAATTAATTCTTTGGAGGAATAAATGCTACAATAAACATCAATAATCCCATAATT
GGTAACACCATCCCGATTAGGAATCCTAATCAGTAATAATCGAATATGCAAGGATAGTAA
TTTTAGTATTAACAACCACAAATGAACAAATCTGGATAATATCTTGATATGAATTAGTTG
AATAGTATGTTTCAATAATAACTGATGCTTGATAAGACTTAATAACTGTAACAATAGTAA
TATCCAGCAGCACAGACTCAAGTCTACAATGATCCCAGAAACCCCTACATAGTTTAAGAT
CAAACCTTTATCCCTCAAAGACAAGTTTAACCAGGCTTACCTCCAAAATCCCATTCTTAT
CACCCCCAAATGTAACAAAAGCATCCTTAAGTATAAAGTAACAGCTTAGGCAGCCTTTAA
TTTAACAACTAATACTCAGCTGGTCCACAAAAATTAACTCCATTTGAGGTTGCTCAAGTA
AATATGATGAGAAAGTTTAGTTTTGGCAGCTAATAGAGTTAAGGATCTCATGGCCATTCA
TCTTAGATCAATTTGAATACTGCTAATCAATAACTTATGTATGCGTAGGCTTAATAGCAG
TATTACAACTAAGGCAATCAAATTTATGTTAATGGGATGATGCATCCAAATCTAATGATG
GGTAATAACTAGGCTCCTATTTTCGAAAGATCTTCAAATATAAGTCAAAGATCTACCAGC
TCTATTTTGAGTGGAAATTTACCAGTTAAAGCAGGAATTATTTAGCCTTCTCCTTTCATT
GAGGATTTGAAAGTTAAGTTAAACAGCACAAAGGATTTGACATTGCTCGATTTATAAGCC
CATTTAGCAGAGTGCTCTTTGGATTAGTAGTGTTCTAGATTTATTTAGCAAAGACTGGAA
GATGCTAAAGATGAAGAAAAGTAACTATTGTTTAACGAACTTATGAATGACTCTTAAAAG
TTAATGAAAGATGTATTTGGCAACTATGTTATCCAAAAGATGCTTGAATACGGAAATCAA
AATCAAAGAACCATGCTTTACTAACAAATTAAAGGAAATATGATACCTCTATCTCAAGAT
TAATATGGCTGCAGAGTTGTGTAAAAGGCGCTTGAAGTTGTTACTACTTAACAATAAGAT
GATTTAATTGGAGAGATTAGACCATAAGTTTAACTTTGCGTTGAGGATCCTAACGGAAAT
CATGTAATCCAAAAGATAATTGAATAGGTTTCAAGCGAGAAAGTACAATTTATAGTTGAC
GCATTTAAGGGAAGAGTTTACGAAATGAGTGTTCACTAGTATGGTTGTAGAGTTATTCAA
AGAATGCTAGAACATTGCAAGGAAGATCAGATCAAACCAATATTAGTTGAGGTCTTTGAA
AGAGTGCTTGATTTGACAAAAGATCTTTATGGCAATTATGTGATATCTCATGTATTAGAA
CATGGAGCTTAGAAGTACAAAACATTTGTCATTAATAAAATGAAGAAGAGAGTTGTGTAA
TTGAGCATCCATAAATTTGGTTCAAATGTTATTGAGAAATGTCTATAGCACTCTGATTAA
AAACAGAAAGATGACATAATTGAAGAAATCATTTAAGTCCGACTAATGGATGATGAAACT
TATCAAAGTAATTCTTAGAACTTTACCTTGATGGACGTAATGAAGGATAAATATGGTAAT
TTTGTTATTCAAAGAGTCTTAGATATCTCAAATGAGAACCAGAGAAAGGCTCTTATTGAT
AAAATTCTCAAAGTTGCTCTTCATATGAAAAAGCATAGATCTCATGCAAGACATGTTTTC
AACTTCCTCGAGAAAAATTATAATGTTACAATCGTCTTTGCTGAAGATGAGGAGAAAAAA
GGCTTAAAAAAGAGAAAGAGCACTGCTTCAAAGGGAGGTCATTCACAAAATGCTAACTCT
TAAAATTTAAGACAGTCGAATGCTAGTTCGAACACAATGGACGGCACAAATAAGGTATCT
TCTACAACAAGCTAGAATGGAAGCAAAAAGAGCAAAACTAAAAATTCTAAGAAGAAATTA
AACAACGGTGGAAGCAATACGTTGAACTAAAATTCTAATTAGTAATAGATTTTATTCCAA
AGCGCAAATAATATCAATCTTAACTCTAGCTCTCAAAATGAGTTAGAACTATCTTTAAGT
AAGAAGAGTAATGGTGACTCCCTAATGGAGTTTGACAAAGCCGATTCATTCTTATGTGAA
TGA


>Contig22789.0.g9(protein)
MDKNSFNLPQISGLGSQGFVPPFEQLPILITQDSGNSDFGAQGCVGGFEKQHQSDDPRGG
VETSGGQEQQLIGTLLLDDDDDNDSIFPKAGNFQHTQGTRYPQNTRGQYSMNHKHEGSIQ
NGIDFGDQDLNPGFGLGLHKQRSTSEKQIGNFSVVNQTASTQNYSHNLQFGVIDPDYKYS
NEGIGGRVSKNNIGILDDVEDGLNISQRSSSQYFNNESHIHELNYEQKIFSEGQSFPIGY
QNNNNAPLKLQSNQQNQQSSYIQNFNQNSQMASIIKNENYMQGNMLSEDQIKQIHYQNQL
AEQRQNKNVSNFSESPFQHADDFKSDQSDSYSYGKDINNNLLNNANPFISQTMPPRRQES
QQQFGQNQRQGGIEDMIQQQFSNQFFGGINATININNPIIGNTIPIRNPNQQQSNMQGQQ
FQYQQPQMNKSGQYLDMNQLNSMFQQQLMLDKTQQLQQQQYPAAQTQVYNDPRNPYIVQD
QTFIPQRQVQPGLPPKSHSYHPQMQQKHPQVQSNSLGSLQFNNQYSAGPQKLTPFEVAQV
NMMRKFSFGSQQSQGSHGHSSQINLNTANQQLMYAQAQQQYYNQGNQIYVNGMMHPNLMM
GNNQAPIFERSSNISQRSTSSILSGNLPVKAGIIQPSPFIEDLKVKLNSTKDLTLLDLQA
HLAECSLDQQCSRFIQQRLEDAKDEEKQLLFNELMNDSQKLMKDVFGNYVIQKMLEYGNQ
NQRTMLYQQIKGNMIPLSQDQYGCRVVQKALEVVTTQQQDDLIGEIRPQVQLCVEDPNGN
HVIQKIIEQVSSEKVQFIVDAFKGRVYEMSVHQYGCRVIQRMLEHCKEDQIKPILVEVFE
RVLDLTKDLYGNYVISHVLEHGAQKYKTFVINKMKKRVVQLSIHKFGSNVIEKCLQHSDQ
KQKDDIIEEIIQVRLMDDETYQSNSQNFTLMDVMKDKYGNFVIQRVLDISNENQRKALID
KILKVALHMKKHRSHARHVFNFLEKNYNVTIVFAEDEEKKGLKKRKSTASKGGHSQNANS
QNLRQSNASSNTMDGTNKVSSTTSQNGSKKSKTKNSKKKLNNGGSNTLNQNSNQQQILFQ
SANNINLNSSSQNELELSLSKKSNGDSLMEFDKADSFLCE