Identifiers and Description

Gene Model Identifier

Contig14151.0.g55

Standard Name

PUF3b

Aliases

Contig14151_0_g55

Description

Pumilio-family RNA binding repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00806 ) Pumilio-family RNA binding repeat
  • ( pfam03540 ) Transcription initiation factor TFIID 23-30kDa subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLL013C5.000145777691928e-76PUF3 SGDID:S000003936, Chr XII
from 124714-122075, Geno...
T. thermophilaTTHERM_005584901.0002758036576784e-62Pumilio-family RNA binding rep
eat containing ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14151.0.g55(coding)
ATGTCCCACTAAAACGACCCATAGGCAAATGACAATGAGAATCATTTGATAGGCAACATC
TTGGCAGAAGAAAACTCAGACTCTGATGGAGATGACAGCAAAACATTCTCAAAAGTGGCT
ACAGGATATGGAAATGGATCATTTGGGTTGGGAACATCAGCAGCTTTCGTTGGATCTGCT
CCTGCACAAGACATTAGCTCGAAATTTGGAACTTTTGCTTAAGACTCACCACAGAGTAAA
AAGCATCAGGTTTTCACAGGTGGGCTGAACGGGCTCGTATCTTAGTCATCGGGTTTCAAT
AATTTATTCGGAAGCCAAAATGAATCATATGGTGTAAATGACCAAAACAGACGTACTTCT
GCAAATGACTTTTCAATTACTGCCAATCAAACAGAGATGCAGTTACAGCCTCAATTTCTA
ATGTAGCATCAACTCCTTCAGTAGCAGAGACAAAATATGACTCCAGTCTAATAGTAACAA
TTAAGTGACGCTTTTATACATAACTAATCGGTAATGAGTTCTGGACTAGATCACTCAGGC
AATGGTGGAGCCTAATCAATGATGACATAGGATTAATAAACTAAGGAATAGATGCAAAAT
CAAAATGAAATCTATTCTACTAAACATTATTTTGACTACTATAACAATTTGAACCCCAAA
AATCCTAACCTTCCTTAGCCAACTTATCAAGCTTAGAATGATGTCGATGGATACAAGAAT
CTTAAGTCTAATAATCAAAACGATGTGAGCAGTTTCTTAAGTGAAGTTCAAAGACTTGAG
GAGTTTCAATAAAAAATTGAAAATCTTAAATTGGAAGATCCACTACAAGCTCAAAACCTC
ACACACGAGTAACAAATGTAAATCTTCAATAATTCTTTGAAGAATCAGCAATTTCAAGGA
CATATGCCACCACCAGGTCTGTAATAGCAGCAATAAATGATGTATCCTACTGGACAACAG
ATTCCTTAACAATAAAACTACGGGAATATGTTAGGACAGTAGCAGTAATAATTCAATAAT
TAGAATTCAAATGCTTAACCCTAGTAGTAAAAACAACAGATTTAAAAATAGCCATCAAAC
TTATAGAACAACTTAAGTCAGAAAAATTTATCGACAATTGCAAACAGTAGTAATTAAGGA
CAAAATAGTTAAAATAACAACAGAAGACAAAGAGGGAAGCATAATTAAAATGCAAATCAG
GATTAAATTCAAATGAATCCCAATAAAGCAAATAAAAGTAATCAACAGATTGGTCAAAAC
TAAGGCTACAATTAGTAATATGGACAAGGACCAAATTAGTTGAAAGGATATGCTTCGAAT
CCTTTAATGATAGATGGTGCTCCATAACCACCTCCTATACATTCTCAAATGCCACTTCAT
CACTCTTAATCTTACCCTACATATTAAGATGTAAGAGCAGGATAGATGGGAGCAGGTGGA
TTGTATCCTCCAGCAACTGGATGGCCGCCAGGTTATGGTCCAGGATATAACTAAATGGGG
ATGATGGGTGGACCTCAAGGGCCATAGACTTATAACCAAGGCTTTGGGGGCATGTATACA
CCACCTGCTTAAGCTCAGAATTAAGGTCAATACAATCAAATGATGGGCCAAGGGTACCCA
ATGGGCACTAATGGCTATGGATACCCTTAATATGGAGCTATGGGATATGGATAGTATTAA
GGGGCTCCAGGTTACATGTATCCCGGATAATAGCACTAACATCCATAAAATCAAGGAGGG
CAGCATCATAATAAAAAGATAGGAGGAGGCAATAATAACCCAAAAGGAGTAAATCTAAGT
AGAAACAACAAAGGATTCTAAAAATCTCATACCCAAAGCAACATCCAAAACTATTCTCAA
AATCAAAACTAAATATCCAGTCCTTAAAGTTAAAGCCATAGACAGCACTCTTTAAGTGGG
GATATGAATCAGCAAACAGTTTAGCTTCCTAAGAGTGAATTCTTGGAGGAACTTAGGCAC
AAAATATAGAATGGTGTTAAGATTGAAATTGCTGAGTTGAAGGATCACATCGTAGAATGC
GCCATGGATTAGTATGGAAGTAGATTCATTCAGTAGAAATATGATATTACTTCCTCAGCT
GAGAAAGAACTAATCTTCAATGAAATTCTACCTGAGTCCTTCAATTTAATGAATGATGTC
TTCGGTAACTATGTTGTTCAAAAGTTGTTTGAATATGGAACCGAGGAGCATCGGTCAACT
CTAGCTGAGTAATTGCTTGGAAATGTCCTAAAGTTAACAAAATCCATGTATGGATGCAGA
GTTGTTTAGAAAGCTTTAGAAGTCATATCTCTTCATTAGTAGAAGATCTTAGTATCAGAA
TTGAAAGACAATATAATTGACTGCATAAATGATTAAAACGGCAACCATGTGATTTAGAAA
TGTATTGAGAAGATGCCATGTGATGACATTGAATTTATCATTAAGCCTGTCATTGAAAAA
ACTTCAGAATTGTGCGTTCATACTTATGGGTGCAGAGTCATTCAAAGAGTCTTGGAAAAT
AGCAATGAAGCTTATACAAGATCAATTATAGAAGGAATTCTCAATGACTTGCATAATTTG
ACAATGGATTAATTTGGTAACTATGTGATTTAGCACATCTTGGAGAATGGAAAGGTCCAA
GAAGACAAAGATAGAGTCGTGAAATCGATCAAAGGCAAAGTGATTGAGTTAAGTAATCAC
AAATTTGCAAGTAATGTAGTTGAAAAATGTCTGCAGTATGCAAGTGAGAAAGATAAAGCT
GAGCTAATAGAGGAATTTTTAGATCTCAATTTTGATGAGGAAGCTGCAATGAATTAGAAT
GGCGTTTTGTATCAAATGATGAAAGATCGCTATGGCAACTATGTTATTCAAAAATGCATT
GAAGTGAGTCAAGGCAAGTAAAGAGAAATACTCATGAAGAGAATTACAGCATGCGCCAAT
ATTCTCAAGAAATAGGCTAATTACTCAAGACATGTCTACAACTTTATCGACAAAATGAGC
AGTGAAGGCCAACTGGCTGCTGCATAAGAGTTATAATAACAGCAGCAGTTACAGTAATAA
CAGTAACACAATCAAAAACAGCCCAATTAAAAATAAGGCAATAAGAATGAAAACAGATAG
AGCAATAATAAGAAAGGTTAAAATCAATCTTATCAACAAAACTATCAGCAGTAATAGCAA
TAAGACTACCCAGGTTATATGGAAATGAGCAATTACAACATGCAACTGCATCAACACTAA
CAGCAACTTCCAATTCACTAATAACAGTAAATGGGAAGATATCCTCAACACCCTCCTTCA
CAGCCTATGATCTAACCTTATGGTCAAAATTGGAGCAACCAAGGACATTATTAACAACAT
CCTAATCATCAATAGTACTAGTAACACAATCAACAGTAGAGACATAATAACACTAACCAT
CAAAACAAGAAAAAGCAGTGA


>Contig14151.0.g55(protein)
MSHQNDPQANDNENHLIGNILAEENSDSDGDDSKTFSKVATGYGNGSFGLGTSAAFVGSA
PAQDISSKFGTFAQDSPQSKKHQVFTGGLNGLVSQSSGFNNLFGSQNESYGVNDQNRRTS
ANDFSITANQTEMQLQPQFLMQHQLLQQQRQNMTPVQQQQLSDAFIHNQSVMSSGLDHSG
NGGAQSMMTQDQQTKEQMQNQNEIYSTKHYFDYYNNLNPKNPNLPQPTYQAQNDVDGYKN
LKSNNQNDVSSFLSEVQRLEEFQQKIENLKLEDPLQAQNLTHEQQMQIFNNSLKNQQFQG
HMPPPGLQQQQQMMYPTGQQIPQQQNYGNMLGQQQQQFNNQNSNAQPQQQKQQIQKQPSN
LQNNLSQKNLSTIANSSNQGQNSQNNNRRQRGKHNQNANQDQIQMNPNKANKSNQQIGQN
QGYNQQYGQGPNQLKGYASNPLMIDGAPQPPPIHSQMPLHHSQSYPTYQDVRAGQMGAGG
LYPPATGWPPGYGPGYNQMGMMGGPQGPQTYNQGFGGMYTPPAQAQNQGQYNQMMGQGYP
MGTNGYGYPQYGAMGYGQYQGAPGYMYPGQQHQHPQNQGGQHHNKKIGGGNNNPKGVNLS
RNNKGFQKSHTQSNIQNYSQNQNQISSPQSQSHRQHSLSGDMNQQTVQLPKSEFLEELRH
KIQNGVKIEIAELKDHIVECAMDQYGSRFIQQKYDITSSAEKELIFNEILPESFNLMNDV
FGNYVVQKLFEYGTEEHRSTLAEQLLGNVLKLTKSMYGCRVVQKALEVISLHQQKILVSE
LKDNIIDCINDQNGNHVIQKCIEKMPCDDIEFIIKPVIEKTSELCVHTYGCRVIQRVLEN
SNEAYTRSIIEGILNDLHNLTMDQFGNYVIQHILENGKVQEDKDRVVKSIKGKVIELSNH
KFASNVVEKCLQYASEKDKAELIEEFLDLNFDEEAAMNQNGVLYQMMKDRYGNYVIQKCI
EVSQGKQREILMKRITACANILKKQANYSRHVYNFIDKMSSEGQLAAAQELQQQQQLQQQ
QQHNQKQPNQKQGNKNENRQSNNKKGQNQSYQQNYQQQQQQDYPGYMEMSNYNMQLHQHQ
QQLPIHQQQQMGRYPQHPPSQPMIQPYGQNWSNQGHYQQHPNHQQYQQHNQQQRHNNTNH
QNKKKQ