Identifiers and Description

Gene Model Identifier

Contig7556.0.g34

Standard Name

PUB1c

Aliases

Contig7556_0_g34

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBR212W6.001122775063233e-17NGR1 SGDID:S000000416, Chr II
from 647886-649904, Genom...
T. thermophilaTTHERM_005578100.0000000000000030004923591262316RNA binding protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7556.0.g34(coding)
ATGTTTGGACAACACTAACAACAACAACAGCTAGCTTATCAAACCAACTATGATCCTACT
TTCCCAATACCCCCAATTCCTTCTTCTAGCAACTTTAATAACTTCCATGGTAGTAATTCC
TTTAATAATTCAATCATAACTCTCATTATTCTGCAACTTCTCCTGTTAACAATAACAACT
ACAATAAAAACTCAGCAAATACTTTCAATTCTAACTCAGGATGTGGTGGCTCGAAAACTC
TGTGGATAGGTGACATTGAAAATTGGATGGATGAGCAATATGTTATAATCTTTTCTAGGG
AATTGCTTAAGTAATAAATATAAAGCTCATCAAGAATAAAGACAACAGAAGAATTCATCT
GCACCTCAATTTGGTTACGGTTTTGTTGAGTTTACTTCTCACGAAATTGCCAAGAAGTAT
TTTCACTACACTTAATGGAGCTTCCATTCCAAGTCTTCCAAATAAAAACTTCAAACTCAA
CTGGGCTTCACATTAAGTACTTATAATAAAACTGGTTATCAAAACTATCAGAATAATGGT
CATGCATAAAATTACAGTAATCACCAAGGAAGCAGAAAATAAGAAGAGTATTAGATTTAT
GTGGGTGATTTAGATCCAAATGTCAATGATTAAATGTTGATGATTACTTTTTAAAAGAGA
TATCCTTCAGTGAACTAAGCTAAAGTTATAATGGATCCTATTACAAGATAGTCAAAGTGC
TATGGTTTCGTAAAGTTTGGAATCATTGAAGAAGGCCAGAATGCAATGGCTGAGATGCAA
GGTAAATTGCTGCTTACTAAAGCTATGAAAATTAATCATGCCTCTCAAAAGAAGCAAGAC
GGAGGTGGTTTTCATCAAGGTGCTCCTCAAATGTAGAAAAACTTCCAATATCAAAATCCT
CAATAACTTCCTTACTAGCAGCCATTTGCAGTTTCTATTAGATTTATAGTTGCCAGGAAA
CTAGATATATCCTCCTCACCAGATTTAGTAACCACAATTCTTAAACTAATAACAGTTTGG
AGTTATGATCCTTTGAACTAATCTATGAGTTAAAACTCTCAAATTAATCAAATATAGTTG
CCACCTCTTTTGCCAGTTCTATAGCCTTCTTTCACTCAAAACATAAAATCAGAGTTTCAA
GTTAATCAGCCTTTAACTATTCCTTAAGAAACTTTATAAAGACCTCAATAAGTTTAACAA
GAAACATCTCTTGCTCCAGACCCTATGGACTCTAAGATTTTTCTAGAATAAGCCACGTTC
CCATAAAATTAATTAACTCAACCTCCCATAGATATTCATTAGAACCTATTGCAGTTTTTC
AAAGCTGATTCAATTCAAAACATTTAAGAGCAGATTTCTGCATTAAATCCCTAAGATCAA
GAAACTTTAAACAATTTAATTAAGGACCCTAAATTTTAGTAGCTTTTGGCAGAGTAGAAC
GTCAACACTTCTAAAATTTTGGAAAATTAGGAAAGTAATATCATGAATTAGCAATCTCTA
TAGAGTCCAACTTCATTAAATTCAATTGAAAATCCTGAGTCTGAAAGCACAACTGCTACT
TATGATGACAAAAACTATAATATTTCGTCAAACTGTATTGCTAATCTTAAAGTTGATAAC
TATGAGTAAATTTAAAGTTAAAAACATTAAAATGTTGAAGACTTTGTAACTATTCCAGCA
AAGTTAAGTCAAGATGATATAGAAATTTTGAATAATAGATTTAACAAGGAGCAATTAAAC
AACCCAGAAGTTCAGCATCTGATTTGA


>Contig7556.0.g34(protein)
MFGQHQQQQQLAYQTNYDPTFPIPPIPSSSNFNNFHGSNSFNNSIITLIILQLLLLTITT
TIKTQQILSILTQDVVARKLCGQVTLKIGWMSNMLQSFLGNCLSNKYKAHQEQRQQKNSS
APQFGYGFVEFTSHEIAKKYFHYTQWSFHSKSSKQKLQTQLGFTLSTYNKTGYQNYQNNG
HAQNYSNHQGSRKQEEYQIYVGDLDPNVNDQMLMITFQKRYPSVNQAKVIMDPITRQSKC
YGFVKFGIIEEGQNAMAEMQGKLLLTKAMKINHASQKKQDGGGFHQGAPQMQKNFQYQNP
QQLPYQQPFAVSIRFIVARKLDISSSPDLVTTILKLITVWSYDPLNQSMSQNSQINQIQL
PPLLPVLQPSFTQNIKSEFQVNQPLTIPQETLQRPQQVQQETSLAPDPMDSKIFLEQATF
PQNQLTQPPIDIHQNLLQFFKADSIQNIQEQISALNPQDQETLNNLIKDPKFQQLLAEQN
VNTSKILENQESNIMNQQSLQSPTSLNSIENPESESTTATYDDKNYNISSNCIANLKVDN
YEQIQSQKHQNVEDFVTIPAKLSQDDIEILNNRFNKEQLNNPEVQHLI